1.Construction of a human anti-SARS-CoV-2 scFv library and identification of broad-spectrum neutralizing antibodies.
Huimin YIN ; Hai LYU ; Ying CHI ; Jingxian LIU ; Yongjun JIAO ; Pingmin WEI
Chinese Journal of Cellular and Molecular Immunology 2025;41(2):154-160
Objective To construct a library of human-derived anti-severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) single-chain variable fragments (scFv) and screen for broad-spectrum neutralizing antibodies to identify candidate molecules for the development of diagnostic and therapeutic agents. Methods Peripheral blood mononuclear cells (PBMCs) were isolated from the peripheral blood of patients who had recovered from novel coronavirus infection. Total RNA was extracted from these PBMCs and reverse transcribed into cDNA, which was used as a template for constructing a human anti-SARS-CoV-2 scFv library. Phage display technology was used to screen for scFv antibodies specific to the SARS-CoV-2 S protein. Full-length IgG antibodies were synthesized through sequence analysis and human IgG expression, and their binding capacity and neutralizing activity against SARS-CoV-2 were evaluated. Results A human-derived scFv antibody library against SARS-CoV-2 with a capacity of 1.56×107 CFU was successfully constructed. Two specific scFv antibodies were screened from this library and expressed as full-length IgG antibodies (IgG-A10 and IgG-G6). IgG-A10 exhibited strong neutralizing activity against both the original SARS-CoV-2 strain (WT) and the XBB subvariant of the Omicron variant. However, the neutralizing activity of this antibody against the JN.1 sub lineage of the Omicron BA.2.86 variant was moderate. Conclusion This study has successfully constructed a human anti-SARS-CoV-2 scFv antibody library from the peripheral blood of recovered patients, and screened and expressed anti-SARS-CoV-2 IgG antibodies with neutralizing activity, laying a foundation for the prevention, diagnosis, and treatment of SARS-CoV-2 infection.
Humans
;
Single-Chain Antibodies/genetics*
;
SARS-CoV-2/immunology*
;
COVID-19/immunology*
;
Immunoglobulin G/genetics*
;
Antibodies, Viral/genetics*
;
Peptide Library
;
Spike Glycoprotein, Coronavirus/immunology*
;
Antibodies, Neutralizing/immunology*
;
Leukocytes, Mononuclear/immunology*
;
Broadly Neutralizing Antibodies/immunology*
2.Identification of a nanobody able to catalyze the destruction of the spike-trimer of SARS-CoV-2.
Kai WANG ; Duanfang CAO ; Lanlan LIU ; Xiaoyi FAN ; Yihuan LIN ; Wenting HE ; Yunze ZHAI ; Pingyong XU ; Xiyun YAN ; Haikun WANG ; Xinzheng ZHANG ; Pengyuan YANG
Frontiers of Medicine 2025;19(3):493-506
Neutralizing antibodies have been designed to specifically target and bind to the receptor binding domain (RBD) of spike (S) protein to block severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) virus from attaching to angiotensin converting enzyme 2 (ACE2). This study reports a distinctive nanobody, designated as VHH21, that directly catalyzes the S-trimer into an irreversible transition state through postfusion conformational changes. Derived from camels immunized with multiple antigens, a set of nanobodies with high affinity for the S1 protein displays abilities to neutralize pseudovirion infections with a broad resistance to variants of concern of SARS-CoV-2, including SARS-CoV and BatRaTG13. Importantly, a super-resolution screening and analysis platform based on visual fluorescence probes was designed and applied to monitor single proteins and protein subunits. A spontaneously occurring dimeric form of VHH21 was obtained to rapidly destroy the S-trimer. Structural analysis via cryogenic electron microscopy revealed that VHH21 targets specific conserved epitopes on the S protein, distinct from the ACE2 binding site on the RBD, which destabilizes the fusion process. This research highlights the potential of VHH21 as an abzyme-like nanobody (nanoabzyme) possessing broad-spectrum binding capabilities and highly effective anti-viral properties and offers a promising strategy for combating coronavirus outbreaks.
Single-Domain Antibodies/immunology*
;
Spike Glycoprotein, Coronavirus/metabolism*
;
SARS-CoV-2/immunology*
;
Animals
;
Humans
;
Antibodies, Neutralizing/immunology*
;
Camelus
;
COVID-19/immunology*
;
Antibodies, Viral/immunology*
;
Angiotensin-Converting Enzyme 2
3.Immunogenicity Evaluation of a SARS-CoV-2 BA.2 Subunit Vaccine Formulated with CpG 1826 plus alum Dual Adjuvant.
Yuhan YAN ; Qiudong SU ; Yao YI ; Liping SHEN ; Shengli BI
Biomedical and Environmental Sciences 2024;37(12):1409-1420
OBJECTIVE:
The present study aimed to evaluate the immunogenicity of BA.2 variant receptor binding domain (RBD) recombinant protein formulated with CpG 1826 plus alum dual adjuvant.
METHODS:
The BA.2 variant RBD (residues 308-548) fusing TT-P 2 epitope was obtained from prokaryotic expression system, purification technology and dialysis renaturation, which was designated as Sot protein. The soluble Sot protein formulated with CpG 1826 plus alum dual adjuvant was designated as Sot/CA subunit vaccine and then the BALB/c mice were intramuscularly administrated with two doses of the Sot/CA subunit vaccine at 14-day interval (day 0 and 14). On day 28, the number of effector T lymphocytes secreting IFN-γ and IL-4 in mice spleen were determined by enzyme-linked immunospot (ELISpot) assay. The serum IgG, IgG1 and IgG2a antibodies were examined by enzyme-linked immunosorbent assay (ELISA). In addition, the level of neutralizing antibodies (NAbs) induced by Sot/CA subunit vaccine was also evaluated by the microneutralization assay.
RESULTS:
The high-purity soluble Sot protein with antigenicity was successfully obtained by the prokaryotic expression, protein purification and dialysis renaturation. The Sot/CA subunit vaccine induced a high level of IgG antibodies and NAbs, which were of cross-neutralizing activity against SARS-CoV-2 BA.2 and XBB.1.5 variants. Meanwhile, Sot/CA subunit vaccine also induced a high level of effector T lymphocytes secreting IFN-γ (635.00 ± 17.62) and IL-4 (279.20 ± 13.10), respectively. Combined with a decreased IgG1/IgG2a ratio in the serum, which indicating Sot/CA subunit vaccine induced a Th1-type predominant immune response.
CONCLUSION
The Sot protein formulated with CpG 1826 plus alum dual adjuvant showed that the excellent cellular and humoral immunogenicity, which provided a scientific basis for the development of BA.2 variant subunit vaccines and references for the adjuvant application of subunit vaccines.
Animals
;
COVID-19 Vaccines/immunology*
;
Alum Compounds/pharmacology*
;
Mice, Inbred BALB C
;
Vaccines, Subunit/immunology*
;
Mice
;
SARS-CoV-2/immunology*
;
Oligodeoxyribonucleotides/administration & dosage*
;
Female
;
Adjuvants, Immunologic
;
COVID-19/immunology*
;
Antibodies, Viral/blood*
;
Immunogenicity, Vaccine
;
Spike Glycoprotein, Coronavirus/immunology*
;
Antibodies, Neutralizing/blood*
;
Adjuvants, Vaccine
;
Immunoglobulin G/blood*
4.Does the COVID-19 XBB Omicron subvariant signal the beginning of the end of the pandemic?
Jinghao Nicholas NGIAM ; Abdurrahmaan AL-MUBAARAK ; Sebastian MAURER-STROH ; Paul Anantharajah TAMBYAH
Singapore medical journal 2024;65(12):658-664
All pandemic viruses have eventually adapted to human hosts so that they become more transmissible and less virulent. The XBB Omicron subvariant is rapidly becoming the dominant strain of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) in Singapore from October 2022 and is one of several variants circulating globally with the potential to dominate autumn/winter waves in different countries. The XBB Omicron subvariant has demonstrated increased transmissibility through an apparent propensity for immune evasion. This is to be expected in the natural evolution of a virus in a population highly vaccinated with a vaccine targeting the spike protein of the original Wuhan strain of the virus. This review explores the important implications of the rising prevalence of the SARS-CoV-2 Omicron subvariant for public health in Singapore and beyond.
Humans
;
COVID-19/epidemiology*
;
SARS-CoV-2
;
Singapore/epidemiology*
;
Pandemics
;
COVID-19 Vaccines
;
Immune Evasion
;
Spike Glycoprotein, Coronavirus/immunology*
5.Seroprevalence of IgM and IgG Antibodies against SARS-CoV-2 in Asymptomatic People in Wuhan: Data from a General Hospital Near South China Seafood Wholesale Market during March to April in 2020.
Rui Jie LING ; Yi Han YU ; Jia Yu HE ; Ji Xian ZHANG ; Sha XU ; Ren Rong SUN ; Wang Cai ZHU ; Ming Feng CHEN ; Tao LI ; Hong Long JI ; Huan Qiang WANG
Biomedical and Environmental Sciences 2021;34(9):743-749
The aim of this study was to estimate the seroprevalence of immunoglobulin M (IgM) and G (IgG) antibodies against SARS-CoV-2 in asymptomatic people in Wuhan. This was a cross-sectional study, which enrolled 18,712 asymptomatic participants from 154 work units in Wuhan. Pearson Chi-square test,
Adolescent
;
Adult
;
Aged
;
Aged, 80 and over
;
Antibodies, Viral/blood*
;
COVID-19/immunology*
;
Carrier State/immunology*
;
Child
;
Child, Preschool
;
China/epidemiology*
;
Coronavirus Nucleocapsid Proteins/immunology*
;
Cross-Sectional Studies
;
Female
;
Humans
;
Immunoglobulin G/blood*
;
Immunoglobulin M/blood*
;
Male
;
Middle Aged
;
Occupations/classification*
;
Phosphoproteins/immunology*
;
SARS-CoV-2/immunology*
;
Seroepidemiologic Studies
;
Spike Glycoprotein, Coronavirus/immunology*
;
Young Adult
6.Molecular deconvolution of the neutralizing antibodies induced by an inactivated SARS-CoV-2 virus vaccine.
Xingdong ZHOU ; Hui WANG ; Qun JI ; Mingjuan DU ; Yuexia LIANG ; Huanhuan LI ; Fan LI ; Hang SHANG ; Xiujuan ZHU ; Wei WANG ; Lichun JIANG ; Alexey V STEPANOV ; Tianyu MA ; Nanxin GONG ; Xiaodong JIA ; Alexander G GABIBOV ; Zhiyong LOU ; Yinying LU ; Yu GUO ; Hongkai ZHANG ; Xiaoming YANG
Protein & Cell 2021;12(10):818-823
7.Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice.
Jiaming LAN ; Shuai LU ; Yao DENG ; Bo WEN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Virology 2016;32(1):77-81
Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.
Animals
;
Antibodies, Viral
;
immunology
;
Computational Biology
;
Coronavirus Infections
;
immunology
;
prevention & control
;
virology
;
Female
;
Humans
;
Immunization
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
immunology
;
Peptides
;
administration & dosage
;
genetics
;
immunology
;
Spike Glycoprotein, Coronavirus
;
administration & dosage
;
genetics
;
immunology
;
Viral Vaccines
;
administration & dosage
;
genetics
;
immunology
8.Sequencing and Serologic Identification of S1 Genes of Infectious Bronchitis Viruses Isolated during 2012-2013 in Guangxi Province, China.
Lihua ZHANG ; Cuilan WU ; Zhipeng ZHANG ; Yining HE ; Heming LI ; Lili QIN ; Tianchao WEI ; Meilan MO ; Ping WEI
Chinese Journal of Virology 2016;32(1):62-69
We wished to ascertain the prevalence as well as the genetic and antigenic variation of infectious bronchitis viruses (IBVs) circulating in the Guangxi Province of China in recent years. The S1 gene of 15 IBV field isolates during 2012-2013 underwent analyses in terms of the similarity of amino-acid sequences, creation of phylogenetic trees, recombination, and serologic identification. Similarities in amino-acid sequences among the 15 isolates of the S1 gene were 54.3%-99.6%, and 43.3%-99.3% among 15 isolates and reference strains. Compared with the vaccine strain H120, except for GX-YL130025, the other 14 isolates showed a lower similarity of amino-acid sequences of the S1 gene (65.1-81.4%). Phylogenetic analyses of the S1 gene suggested that 15 IBV isolates were classified into eight genotypes, with the predominant genotype being new-type II. Recombination analyses demonstrated that the S1 gene of the GX-NN130048 isolate originated from recombination events between vaccine strain 4/91 and a LX4-like isolate. Serotyping results suggested that seven serotypes prevailed during 2012-2013 in Guangxi Province, and that only one isolate was consistent with the vaccine strain H120 in serotype (which has been used widely in recent years). The serotype of recombinant isolate GX-NN130048 was different from those of its parent strains. These results suggested that not only the genotype, but also the serotype of IBV field isolates in Guangxi Province had distinct variations, and that increasing numbers of genotypes and serotypes are in circulation. We showed that recombination events can lead to the emergence of new serotypes. Our study provides new evidence for understanding of the molecular mechanisms of IBV variations, and the development of new vaccines against IBVs.
Animals
;
Antibodies, Viral
;
blood
;
Chickens
;
China
;
Coronavirus Infections
;
blood
;
veterinary
;
virology
;
Genetic Variation
;
Genotype
;
Infectious bronchitis virus
;
classification
;
genetics
;
immunology
;
isolation & purification
;
Molecular Sequence Data
;
Phylogeny
;
Poultry Diseases
;
blood
;
virology
;
Sequence Homology, Amino Acid
;
Spike Glycoprotein, Coronavirus
;
chemistry
;
genetics
;
immunology
9.Production and immunogenicity of chimeric virus-like particles containing the spike glycoprotein of infectious bronchitis virus.
Lishan LV ; Xiaoming LI ; Genmei LIU ; Ran LI ; Qiliang LIU ; Huifang SHEN ; Wei WANG ; Chunyi XUE ; Yongchang CAO
Journal of Veterinary Science 2014;15(2):209-216
Infectious bronchitis virus (IBV) poses a severe threat to the poultry industry and causes heavy economic losses worldwide. Vaccination is the most effective method of preventing infection and controlling the spread of IBV, but currently available inactivated and attenuated virus vaccines have some disadvantages. We developed a chimeric virus-like particle (VLP)-based candidate vaccine for IBV protection. The chimeric VLP was composed of matrix 1 protein from avian influenza H5N1 virus and a fusion protein neuraminidase (NA)/spike 1 (S1) that was generated by fusing IBV S1 protein to the cytoplasmic and transmembrane domains of NA protein of avian influenza H5N1 virus. The chimeric VLPs elicited significantly higher S1-specific antibody responses in intramuscularly immunized mice and chickens than inactivated IBV viruses. Furthermore, the chimeric VLPs induced significantly higher neutralization antibody levels than inactivated H120 virus in SPF chickens. Finally, the chimeric VLPs induced significantly higher IL-4 production in mice. These results demonstrate that chimeric VLPs have the potential for use in vaccines against IBV infection.
Animals
;
Antibodies, Viral/blood
;
*Chickens
;
Chimera/genetics/immunology
;
Coronavirus Infections/prevention & control/*veterinary/virology
;
Female
;
*Immunity, Innate
;
Infectious bronchitis virus/genetics/*immunology
;
Influenza A Virus, H5N1 Subtype/genetics/immunology
;
Injections, Intramuscular/veterinary
;
Mice
;
Mice, Inbred BALB C
;
Neuraminidase/genetics
;
Poultry Diseases/*prevention & control/virology
;
Recombinant Fusion Proteins/genetics/immunology
;
Spike Glycoprotein, Coronavirus/genetics/*immunology
;
Vaccines, Synthetic/administration & dosage/genetics/immunology
;
Vaccines, Virus-Like Particle/administration & dosage/genetics/*immunology
;
Viral Proteins/genetics
10.Construction and screening of SARS-CoV S protein-specific phage displayed antigen library.
Rui-Ping WU ; Jia-Zi MENG ; Yu-Xian HE
Chinese Journal of Virology 2013;29(3):280-286
The aim of this study is to construct a SARS-CoV S protein-specific phage displayed antigen library for the epitope characterization of anti-S monoclonal antibodies (mAbs). First, the full-length gene of SARS-S protein was PCR amplified, purified and then digested with DNase I to obtain DNA fragments in the size range of 50-500 bp. The resulting fragments were blunt-end ligated to the modified phage display vector pComb3XSS. The reactions were electrotransformed into XL1-Blue and infected with VCSM13 helper phage. The SARS-CoV S protein-specific phage displayed antigen library was biopanned and screened against two anti-S mAbs, S-M1 and S-M2. The results showed that we successfully constructed the phage displayed antigen library with a size of 5.7 x 10(6). After three-rounds of biopanning, 14 positive phage clones for S-M1 and 15 for S-M2 were respectively identified. Sequence analyses revealed the possible epitopes of two mAbs. Therefore, the S protein-specific phage displayed antigen library provides a crucial platform for the epitope characterization of anti-S antibodies and it is highly valuable for development of SARS vaccines and diagnostics.
Antibodies, Viral
;
immunology
;
Bacteriophages
;
genetics
;
metabolism
;
Epitopes
;
genetics
;
immunology
;
Humans
;
Membrane Glycoproteins
;
genetics
;
immunology
;
Peptide Library
;
SARS Virus
;
genetics
;
immunology
;
Severe Acute Respiratory Syndrome
;
immunology
;
virology
;
Spike Glycoprotein, Coronavirus
;
Viral Envelope Proteins
;
genetics
;
immunology

Result Analysis
Print
Save
E-mail