1.The role of neutrophils in triptolide-induced liver injury.
Xin-Zhi WANG ; Shen-Ye ZHANG ; Yao XU ; Lu-Yong ZHANG ; Zhen-Zhou JIANG
Chinese Journal of Natural Medicines (English Ed.) 2018;16(9):653-664
Triptolide (TP) induces severe liver injury, but its hepatotoxicity mechanisms are still unclear. Inflammatory responses may be involved in the pathophysiology. Neutrophils are the first-line immune effectors for sterile and non-sterile inflammatory responses. Thus, the aim of the present study was to investigate the neutrophilic inflammatory response in TP-induced liver injury in C57BL/6 mice. Our results showed that neutrophils were recruited and accumulated in the liver, which was parallel to or slightly after the development of liver injury. Neutrophils induced release of myeloperoxidase and up-regulation of CD11b, which caused cytotoxicity and hepatocyte death. Hepatic expressions of CXL1, TNF-α, IL-6, and MCP1 were increased significantly to regulate neutrophils recruitment and activation. Up-regulation of toll like receptors 4 and 9 also facilitated neutrophils infiltration. Moreover, neutrophils depletion using an anti-Gr1 antibody showed mild protection against TP overdose. These results indicated that neutrophils accumulation might be the secondary response, not the cause of TP-induced liver injury. In conclusion, the inflammatory response including neutrophil infiltration may play a role in TP-induced hepatotoxicity, but may not be severe enough to cause additional liver injury.
Animals
;
Chemical and Drug Induced Liver Injury
;
etiology
;
immunology
;
Chemokine CCL2
;
genetics
;
immunology
;
Diterpenes
;
adverse effects
;
Drugs, Chinese Herbal
;
adverse effects
;
Epoxy Compounds
;
adverse effects
;
Female
;
Humans
;
Interleukin-6
;
genetics
;
immunology
;
Intracellular Signaling Peptides and Proteins
;
genetics
;
immunology
;
Liver
;
drug effects
;
immunology
;
Mice
;
Mice, Inbred C57BL
;
Neutrophil Infiltration
;
drug effects
;
Neutrophils
;
drug effects
;
immunology
;
Phenanthrenes
;
adverse effects
;
Tripterygium
;
adverse effects
;
chemistry
;
Tumor Necrosis Factor-alpha
;
genetics
;
immunology
2.Effects of Gardenia jasminoides extracts on cognition and innate immune response in an adult Drosophila model of Alzheimer's disease.
Wei-Wei MA ; Ye TAO ; Yan-Ying WANG ; I-Feng PENG
Chinese Journal of Natural Medicines (English Ed.) 2017;15(12):899-904
Herbal extracts have been extensively used worldwide for their application on memory improvement, especially among aged and memory-deficit populations. In the present study, the memory loss induced by human Abeta protein over-expression in fruitfly Alzheimer's disease (AD) model was rescued by multiple extracts from Gardenia jasminoides. Three extracts that rich with gardenia yellow, geniposide, and gardenoside components showed distinct rescue effect on memory loss. Further investigation on adding gardenoside into a formula of Ganoderma lucidum, Panax notoginseng and Panax ginseng (GPP) also support its therapeutic effects on memory improvement. Interestingly, the application of GPP and gardenoside did not alter the accumulation of Abeta proteins but suppressed the expression of immune-related genes in the brain. These results revealed the importance and relevancy of anti-inflammation process and the underlying mechanisms on rescuing memory deficits, suggesting the potential therapeutic use of the improved GPP formulation in improving cognition in defined population in the future.
Alzheimer Disease
;
drug therapy
;
Animals
;
Antimicrobial Cationic Peptides
;
genetics
;
Brain
;
drug effects
;
immunology
;
Cognition
;
drug effects
;
Disease Models, Animal
;
Drosophila
;
Drosophila Proteins
;
genetics
;
Gardenia
;
chemistry
;
Gene Expression Regulation
;
drug effects
;
Immunity, Innate
;
drug effects
;
Iridoids
;
chemistry
;
isolation & purification
;
pharmacology
;
Plant Extracts
;
chemistry
;
isolation & purification
;
pharmacology
;
Polymerase Chain Reaction
3.Prokaryotic expression and purification of Chlamydomonas reinhardtii intraflagellar transport protein 46(IFT46) and preparation of polyclonal antibody.
Haiyue REN ; Bin DONG ; Zhenchuan FAN ; Demei MENG
Chinese Journal of Biotechnology 2016;32(8):1124-1132
IFT46 is one of the important components of intraflagellar transport complex B in Chlamydomonas reinhardtii, and plays important roles in the assembly, movement and perception of ciliary. To study its functional mechanism, a GST-tagged and an MBP-tagged prokaryotic expression plasmid, pGEX-2T-ift46 and pMAL-C2X-ift46 were constructed, respectively, by inserting ift46 into the pGEX-2T and pMAL-C2X vector, and then transformed into Escherichia coli BL21 (DE3) for protein expression. SDS-PAGE (15%) analysis results showed that the molecular weights of the fusion protein GST-IFT46 and MBP-IFT46 were 70 kDa and 86 kDa, respectively. We used the fusion protein GST-IFT46 purified by affinity adsorption purification (more than 95% purity) for immunity to New Zealand white rabbits. The 5th immune serum was collected and the antibody titer was determined to be 256 000 by ELISA. The antiserum was purified by Protein A affinity adsorption purification and immobilized MBP-IFT46 purification, and the specificity of polyclonal antibodies was evaluated by Western blotting and immunofluorescence. Results showed that the polyclonal antibody prepared could specifically and precisely bind IFT46 in C. reinhardtii, and IFT46 was mainly concentrated at basal body regions and few localized along the entire length of the flagellum as punctuated dots, which will make a foundation to further study the mechanism of IFT46 in cilia related diseases such as obesity, diabetes and polycystic kidney disease.
Algal Proteins
;
biosynthesis
;
immunology
;
Animals
;
Antibodies
;
chemistry
;
Blotting, Western
;
Chlamydomonas reinhardtii
;
chemistry
;
genetics
;
Electrophoresis, Polyacrylamide Gel
;
Enzyme-Linked Immunosorbent Assay
;
Escherichia coli
;
Fluorescent Antibody Technique
;
Intracellular Signaling Peptides and Proteins
;
biosynthesis
;
immunology
;
Plasmids
;
Rabbits
;
Recombinant Fusion Proteins
;
biosynthesis
4.A novel M2e-multiple antigenic peptide providing heterologous protection in mice.
Feng WEN ; Ji Hong MA ; Hai YU ; Fu Ru YANG ; Meng HUANG ; Yan Jun ZHOU ; Ze Jun LI ; Xiu Hui WANG ; Guo Xin LI ; Yi Feng JIANG ; Wu TONG ; Guang Zhi TONG
Journal of Veterinary Science 2016;17(1):71-78
Swine influenza viruses (SwIVs) cause considerable morbidity and mortality in domestic pigs, resulting in a significant economic burden. Moreover, pigs have been considered to be a possible mixing vessel in which novel strains loom. Here, we developed and evaluated a novel M2e-multiple antigenic peptide (M2e-MAP) as a supplemental antigen for inactivated H3N2 vaccine to provide cross-protection against two main subtypes of SwIVs, H1N1 and H3N2. The novel tetra-branched MAP was constructed by fusing four copies of M2e to one copy of foreign T helper cell epitopes. A high-yield reassortant H3N2 virus was generated by plasmid based reverse genetics. The efficacy of the novel H3N2 inactivated vaccines with or without M2e-MAP supplementation was evaluated in a mouse model. M2e-MAP conjugated vaccine induced strong antibody responses in mice. Complete protection against the heterologous swine H1N1 virus was observed in mice vaccinated with M2e-MAP combined vaccine. Moreover, this novel peptide confers protection against lethal challenge of A/Puerto Rico/8/34 (H1N1). Taken together, our results suggest the combined immunization of reassortant inactivated H3N2 vaccine and the novel M2e-MAP provided cross-protection against swine and human viruses and may serve as a promising approach for influenza vaccine development.
Animals
;
Antibodies, Viral/blood
;
Antigens, Viral/genetics/*immunology
;
Body Weight
;
Cross Protection/*immunology
;
Disease Models, Animal
;
Epitopes, T-Lymphocyte/genetics/immunology
;
Female
;
Influenza A Virus, H3N2 Subtype/genetics/*immunology
;
Influenza Vaccines/*immunology
;
Mice
;
Mice, Inbred BALB C
;
Orthomyxoviridae Infections/*immunology/mortality/pathology/prevention & control
;
Peptides/genetics/*immunology
;
Random Allocation
;
Survival Analysis
;
Vaccines, Synthetic/immunology
;
Virus Replication
5.Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice.
Jiaming LAN ; Shuai LU ; Yao DENG ; Bo WEN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Virology 2016;32(1):77-81
Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.
Animals
;
Antibodies, Viral
;
immunology
;
Computational Biology
;
Coronavirus Infections
;
immunology
;
prevention & control
;
virology
;
Female
;
Humans
;
Immunization
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
immunology
;
Peptides
;
administration & dosage
;
genetics
;
immunology
;
Spike Glycoprotein, Coronavirus
;
administration & dosage
;
genetics
;
immunology
;
Viral Vaccines
;
administration & dosage
;
genetics
;
immunology
6.Greater prevalence of seropositivity for anti-cyclic citrullinated peptide antibody in unaffected first-degree relatives in multicase rheumatoid arthritis-affected families.
Seong Kyu KIM ; Jisuk BAE ; Hwajeong LEE ; Ji Hun KIM ; Sung Hoon PARK ; Jung Yoon CHOE
The Korean Journal of Internal Medicine 2013;28(1):45-53
BACKGROUND/AIMS: This study determined the prevalence and determinants of seropositivity for rheumatoid factor (RF), anti-cyclic citrullinated peptide (anti-CCP) antibody, and anti-mutated citrullinated vimentin (anti-MCV) antibody in unaffected first-degree relatives (FDRs) of rheumatoid arthritis (RA) patients. METHODS: A total of 337 subjects (135 with RA and 202 FDRs) were enrolled in this case-control study. Serum RF, anti-CCP antibody, and anti-MCV antibody were assayed. Subjects in multicase families (> or = 2 affected FDRs within the same family) were identified. Multivariate logistic regression analysis was used to identify risk factors associated with RA-related autoantibodies. RESULTS: Seropositivity for RF, anti-CCP antibody, or anti-MCV antibody was detected in 14.4%, 5.0%, or 13.4% of unaffected FDRs, respectively. Anti-CCP antibody seropositivity was more prevalent in FDRs in multicase families (17.8%) than in those not in multicase families (1.3%, p < 0.0001). Significant correlations between RA-associated autoantibodies were detected in the FDR group (between RF and anti-CCP antibody: r = 0.366, p < 0.0001; between RF and anti-MCV antibody: r = 0.343, p < 0.0001; and between anti-CCP antibody and anti-MCV antibody: r = 0.849, p < 0.0001). After adjustment for age and sex, anti-CCP antibody seropositivity in FDRs was significantly associated with being in a multicase family (odds ratio, 49.8; 95% confidence interval, 5.6 to 441.6). CONCLUSIONS: The association between anti-CCP antibody seropositivity in unaffected FDRs and being in a multicase family suggests that genetic and/or environmental factors may increase the risk for RA development in unaffected FDRs.
Adolescent
;
Adult
;
Arthritis, Rheumatoid/blood/*epidemiology/genetics/*immunology
;
Autoantibodies/*blood
;
Biological Markers/blood
;
Case-Control Studies
;
Chi-Square Distribution
;
Cross-Sectional Studies
;
Female
;
Gene-Environment Interaction
;
Genetic Predisposition to Disease
;
Humans
;
Logistic Models
;
Male
;
Middle Aged
;
Multivariate Analysis
;
Odds Ratio
;
Pedigree
;
Peptides, Cyclic/*immunology
;
Republic of Korea/epidemiology
;
Risk Factors
;
Seroepidemiologic Studies
;
Vimentin/immunology
;
Young Adult
7.Construction and immunogenicity of recombinant bacteriophage T7 vaccine expressing M2e peptides of avian influenza virus.
Hai XU ; Yi-Wei WANG ; Ying-Hua TANG ; Qi-Sheng ZHENG ; Ji-Bo HOU
Chinese Journal of Virology 2013;29(4):376-381
To construct a recombinant T7 phage expressing matrix protein 2 ectodomain (M2e) peptides of avian influenza A virus and test immunological and protective efficacy in the immunized SPF chickens. M2e gene sequence was obtained from Genbank and two copies of M2e gene were artificially synthesised, the M2e gene was then cloned into the T7 select 415-1b phage in the multiple cloning sites to construct the recombinant phage T7-M2e. The positive recombinant phage was identified by PCR and sequencing, and the expression of surface fusion protein was confirmed by SDS-PAGE and Western-blot. SPF chickens were subcutaneously injected with 1 X 10(10) pfu phage T7-M2e, sera samples were collected pre- and post-vaccination, and were tested for anti-M2e antibody by ELISA. The binding capacity of serum to virus was also examined by indirect immunofluorescence assay in virus- infected CEF. The immunized chickens were challenged with 200 EID50 of H9 type avian influenza virus and viral isolation rate was calculated to evaluate the immune protective efficacy. A recombinant T7 phage was obtained displaying M2e peptides of avian influenza A virus, and the fusion protein had favorable immunoreactivity. All chickens developed a certain amount of anti-M2e antibody which could specially bind to the viral particles. In addition, the protection efficacy of phage T7-M2e vaccine against H9 type avian influenza viruses was 4/5 (80%). These results indicate that the recombinant T7 phage displaying M2e peptides of avian influenza A virus has a great potential to be developed into a novel vaccine for the prevention of avian influenza infection.
Animals
;
Antibodies, Viral
;
blood
;
Bacteriophage T7
;
genetics
;
immunology
;
metabolism
;
Chickens
;
Enzyme-Linked Immunosorbent Assay
;
Gene Expression Regulation, Viral
;
Immunization
;
Influenza A virus
;
genetics
;
immunology
;
Influenza Vaccines
;
immunology
;
Influenza in Birds
;
immunology
;
metabolism
;
prevention & control
;
Peptides
;
genetics
;
immunology
;
metabolism
;
Polymerase Chain Reaction
;
Recombinant Fusion Proteins
;
Specific Pathogen-Free Organisms
;
Viral Matrix Proteins
;
genetics
;
immunology
;
metabolism
8.Effect of IL-18BP on Fractalkine chemokine expression in the kidney tissue of rats with renal fibrosis.
Li-Min WANG ; Chun-Yu LI ; Jia-Bin ZHANG ; Yu WANG ; Ying-Jiao CHI ; Jing-Wei YUAN ; Ying-Jie ZHANG
Chinese Journal of Contemporary Pediatrics 2013;15(12):1134-1138
OBJECTIVETo study the expression of Fractalkine (FKN) in the kidney tissue of rats with renal fibrosis and the effect of IL-18BP on FKN.
METHODSMale Wister rats were randomly assigned to sham-operation (n=24), unilatral ureteral obstruction (UUO, n=22), and IL-18 binding protein (IL-18BP) treatment groups (n=23). The UUO model was prepared by unilateral ureteral ligation in the later two groups. The IL-18BP treatment group received an intraperitoneal injection of IL-18BP (0.1 mg/kg) every other day after UUO inducement, for 7 times, while normal saline was administered in the other two groups. Seven or eight rats of every group were sacrificed at 3, 7 or 14 days after IL-18BP or normal saline injections. FKN levels at various times were detected by immunohistochemistry and Western blot.
RESULTSCompared with the sham-operation group, FKN levels in the kidney tissue of the untreated UUO group increased significantly at all time points (P<0.01). IL-18BP treatment decreased significantly FKN levels in the kidney tissue at all time points compared with the untreated UUO group (P<0.01).
CONCLUSIONSIL-18BP treatment may down-regulate the increased FKN levels of the rat kidney tissue caused by UUO, possibly thus delays the occurrence and development of renal fibrosis.
Animals ; Blotting, Western ; Chemokine CX3CL1 ; genetics ; Fibrosis ; Intercellular Signaling Peptides and Proteins ; pharmacology ; Kidney ; immunology ; pathology ; Male ; Rats ; Rats, Wistar ; Ureteral Obstruction ; immunology
9.Expression regulation and function of NLRC5.
Protein & Cell 2013;4(3):168-175
The NOD like receptors (NLRs), a class of intracellular receptors that respond to pathogen attack or cellular stress, have gained increasing attention. NLRC5, the largest member of the NLR protein family, has recently been identified as a critical regulator of immune responses. While NLRC5 is constitutively and widely expressed, it can be dramatically induced by interferons during pathogen infections. Both in vitro and in vivo studies have demonstrated that NLRC5 is a specific and master regulator of major mistocompatibility complex (MHC) class I genes as well as related genes involved in MHC class I antigen presentation. The expression of MHC class I genes is regulated by NLRC5 in coordination with the RFX components through an enhanceosome-dependent manner. And the involvement of NLRC5 in MHC class I mediated CD8+ T cell activation, proliferation and cytotoxicity is proved to be critical for host defense against intracellular bacterial infections. Nevertheless, the role of NLRC5 in innate immunity remains to be further explored. Here, we review the research advances on the structure, expression regulation and function of NLRC5.
Animals
;
CD8-Positive T-Lymphocytes
;
immunology
;
metabolism
;
Histocompatibility Antigens Class I
;
genetics
;
metabolism
;
Humans
;
Immunity, Innate
;
Intracellular Signaling Peptides and Proteins
;
chemistry
;
genetics
;
metabolism
10.Exendin-4 improves resistance to Listeria monocytogenes infection in diabetic db/db mice.
Hsien Yueh LIU ; Chih Yao CHUNG ; Wen Chin YANG ; Chih Lung LIANG ; Chi Young WANG ; Chih Yu CHANG ; Cicero Lee Tian CHANG
Journal of Veterinary Science 2012;13(3):245-252
The incidence of diabetes mellitus is increasing among companion animals. This disease has similar characteristics in both humans and animals. Diabetes is frequently identified as an independent risk factor for infections associated with increased mortality. In the present study, homozygous diabetic (db/db) mice were infected with Listeria (L.) monocytogenes and then treated with the anti-diabetic drug exendin-4, a glucagon-like peptide 1 analogue. In aged db/db mice, decreased CD11b+ macrophage populations with higher lipid content and lower phagocytic activity were observed. Exendin-4 lowered high lipid levels and enhanced phagocytosis in macrophages from db/db mice infected with L. monocytogenes. Exendin-4 also ameliorated obesity and hyperglycemia, and improved ex vivo bacteria clearance by macrophages in the animals. Liver histology examined during L. monocytogenes infection indicated that abscess formation was much milder in exendin-4-treated db/db mice than in the control animals. Moreover, mechanistic studies demonstrated that expression of ATP binding cassette transporter 1, a sterol transporter, was higher in macrophages isolated from the exendin-4-treated db/db mice. Overall, our results suggest that exendin-4 decreases the risk of infection in diabetic animals by modifying the interaction between intracellular lipids and phagocytic macrophages.
ATP-Binding Cassette Transporters/metabolism
;
Age Factors
;
Animals
;
Blood Chemical Analysis
;
Cholesterol/metabolism
;
Diabetes Mellitus, Type 2/*drug therapy/genetics
;
Dyslipidemias/drug therapy/genetics
;
Female
;
Hyperglycemia/drug therapy/genetics
;
Hypoglycemic Agents/*therapeutic use
;
Injections, Intraperitoneal
;
*Lipid Metabolism/drug effects
;
Listeria monocytogenes/*drug effects/immunology
;
Listeriosis/*drug therapy/immunology/microbiology
;
Macrophages/drug effects/*metabolism
;
Mice
;
Obesity/drug therapy/genetics
;
Peptides/*therapeutic use
;
Phagocytosis/drug effects
;
Venoms/*therapeutic use

Result Analysis
Print
Save
E-mail