1.Boosting with Omicron-specific mRNA vaccine or historical SARS-CoV-2 vaccines elicits discriminating immune responses against Omicron variants.
Yi WU ; Xiaoying JIA ; Namei WU ; Xinghai ZHANG ; Yan WU ; Yang LIU ; Minmin ZHOU ; Yanqiong SHEN ; Entao LI ; Wei WANG ; Jiaming LAN ; Yucai WANG ; Sandra CHIU
Acta Pharmaceutica Sinica B 2025;15(2):947-962
Booster vaccinations are highly recommended in combating the SARS-CoV-2 Omicron variant and its subvariants. However, the optimal booster vaccination strategies and related immune mechanisms with different prior vaccinations are under-revealed. In this study, we systematically evaluated the immune responses in mice and hamsters with different prime-boost regimens before their protective efficacies against Omicron were detected. We found that boosting with Ad5-nCoV, SWT-2P or SOmicron-6P induced significantly higher levels of neutralization activities against Omicron variants than CoronaVac and ZF2001 by eliciting stronger germinal center (GC) responses. Specifically, SOmicron-6P induced even stronger antibody responses against Omicron variants in CoronaVac and Ad5-nCoV-primed animals than non-Omicron-specific vaccines but with limited differences as compared to Ad5-nCoV and SWT-2P. In addition, boosting with a specific vaccine has the potential to remodel the existing immune profiles. These findings indicated that adenovirus-vectored vaccines and mRNA vaccines would be more effective than other types of vaccines as booster shots in combating Omicron infections. Moreover, the protective efficacies of the vaccines in booster vaccinations are highly related to GC reactions in secondary lymphatic organs. In summary, these findings provide timely important information on prime-boost regimens and future vaccine design.
2.Investigation on knowledge,attitude and practice of cephalosporins skin test among medical staff in China
Jiaming LIU ; Yanqi CHU ; Lan ZHANG
Chinese Journal of Pharmacoepidemiology 2024;33(6):621-631
Objective To analyze the current situation and influencing factors of knowledge,attitude and practice among medical personnel in medical institutions in China regarding skin testing of cephalosporins,to provide reference for standardizing medical behavior related to skin test.Methods A self-designed questionnaire on knowledge,attitude and practice of cephalosporins skin test was used to survey medical staff in China.The questionnaire QR code was distributed to medical institutions nationwide through WeChat,and participants participated voluntarily and anonymously.Knowledge,attitude,and practice scores of medical staff with different educational level,job positions,professional titles were calculated,and influencing factors were analyzed using Wilcoxon rank sum test,multiple linear regression analysis,and other statistical methods.Results 873 medical staff from 205 medical institutions in 30 provinces participated in this survey.The scores of knowledge(total score 16),attitude(total score 20)and practice(total score 20)in the cephalosporins skin test were 10(8,12),13(12,15)and 12(9,15),respectively.The results of multiple linear regression showed that educational level,job position and professional title were correlated with knowledge and attitude scores(P<0.05).Graduate medical personnel had better knowledge and positive attitudes than specialized medical personnel.Pharmacists had better knowledge and a positive attitude than doctors and nurses.Medical personnel with intermediate and senior professional titles had better knowledge mastery and a positive attitude than those with junior and lower professional titles.Knowledge level is positively correlated with attitude(P<0.05).Gender,job position and professional title were correlated with practice scores(P<0.05).Female medical staff exhibited less positive practice than the male medical staff.Nurses exhibited more positive practices than pharmacists.Medical personnel with senior professional titles exhibited more positive practice than those with junior and lower professional titles.Knowledge,attitude was positively correlated with practice(P<0.05).There was no statistically significant difference in the mediating effect of attitude on the influence of knowledge on practice(P=0.085).Conclusion The knowledge,attitude and practice of cephalosporins skin test among medical personnel in China need to be strengthened.Training programs should be tailored to address the differences in knowledge,attitude,and practice among medical staff in different positions and professional titles,to enhance knowledge levels,establish positive attitudes,and standardize skin test-related medical behavior.
3.Application of blended learning in Clinical Biochemistry
Jiaming FAN ; Qianyin LI ; Ling LI ; Lan ZHOU ; Xuemei ZHANG ; Yibing YIN ; Yujuan HE ; Yan ZHANG
Chinese Journal of Medical Education Research 2022;21(7):850-852
Objective:To explore the role of blended learning in the undergraduate teaching of Clinical Biochemistry. Methods:The Batch 2017 medical laboratory technology undergraduates ( n=134) were selected as research objects, and the effect and opinions of blended learning were statistically analyzed by questionnaire survey and online-offline platform data. SPSS 23.0 was used to conduct rank sum test. Results:The application of blended learning in the Clinical Biochemistry teaching affected the learning effect in an all-round way. The average score increased from 70 (64, 76) to 79 (71, 85), with statistical difference ( Z=6.69, P<0.001). Conclusion:The combined application of blended learning, problem-based learning, flipped classroom and formative assessment is conducive to teaching students in accordance with their aptitude and cultivating students' clinical thinking ability.
4.The nucleocapsid protein of rice stripe virus in cell nuclei of vector insect regulates viral replication.
Wan ZHAO ; Junjie ZHU ; Hong LU ; Jiaming ZHU ; Fei JIANG ; Wei WANG ; Lan LUO ; Le KANG ; Feng CUI
Protein & Cell 2022;13(5):360-378
Rice stripe virus (RSV) transmitted by the small brown planthopper causes severe rice yield losses in Asian countries. Although viral nuclear entry promotes viral replication in host cells, whether this phenomenon occurs in vector cells remains unknown. Therefore, in this study, we systematically evaluated the presence and roles of RSV in the nuclei of vector insect cells. We observed that the nucleocapsid protein (NP) and viral genomic RNAs were partially transported into vector cell nuclei by utilizing the importin α nuclear transport system. When blocking NP nuclear localization, cytoplasmic RSV accumulation significantly increased. In the vector cell nuclei, NP bound the transcription factor YY1 and affected its positive regulation to FAIM. Subsequently, decreased FAIM expression triggered an antiviral caspase-dependent apoptotic reaction. Our results reveal that viral nuclear entry induces completely different immune effects in vector and host cells, providing new insights into the balance between viral load and the immunity pressure in vector insects.
Animals
;
Cell Nucleus
;
Hemiptera/metabolism*
;
Insect Vectors/genetics*
;
Insecta
;
Nucleocapsid Proteins/metabolism*
;
Oryza
;
Plant Diseases
;
Tenuivirus/metabolism*
;
Virus Replication
5.Chinese expert consensus on the management of immune-related adverse events of hepato-cellular carcinoma treated with immune checkpoint inhibitors (2021 edition)
Guoming SHI ; Xiaoyong HUANG ; Zhenggang REN ; Yi CHEN ; Leilei CHENG ; Shisuo DU ; Yi FANG ; Ningling GE ; Aimin LI ; Su LI ; Xiaomu LI ; Qian LU ; Pinxiang LU ; Jianfang SUN ; Hanping WANG ; Lai WEI ; Li XU ; Guohuan YANG ; Zhaochong ZENG ; Lan ZHANG ; Li ZHANG ; Haitao ZHAO ; Ling ZHAO ; Ming ZHAO ; Aiping ZHOU ; Rongle LIU ; Xinhui LIU ; Jiaming WU ; Ying ZHANG ; Jia FAN ; Jian ZHOU
Chinese Journal of Digestive Surgery 2021;20(12):1241-1258
The clinical application of immune checkpoint inhibitors (ICIs) has significantly improved the prognosis of hepatocellular carcinoma (HCC) patients. With the widespread applica-tion of ICIs in HCC, the management of immune-related adverse events (irAE) gained more and more attention. However, the complicated disease characteristics and various combination therapies in HCC throw out challenges to irAE management. Therefore, the editorial board of the 'Chinese expert consensus on the management of immune-related adverse events of hepatocellular carcinoma treated with immune checkpoint inhibitors (2021 edition)' organizes multidisciplinary experts to discuss and formulate this consensus. The consensus focuses on issues related to HCC irAE manage-ment, and puts forward suggestions, in order to improve standardized and safety clinical medication, so as to maximize the benefits of immunotherapy for patients.
7.Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice.
Jiaming LAN ; Shuai LU ; Yao DENG ; Bo WEN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Virology 2016;32(1):77-81
Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.
Animals
;
Antibodies, Viral
;
immunology
;
Computational Biology
;
Coronavirus Infections
;
immunology
;
prevention & control
;
virology
;
Female
;
Humans
;
Immunization
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
immunology
;
Peptides
;
administration & dosage
;
genetics
;
immunology
;
Spike Glycoprotein, Coronavirus
;
administration & dosage
;
genetics
;
immunology
;
Viral Vaccines
;
administration & dosage
;
genetics
;
immunology
8.Screening of mouse-derived monoclonal antibodies against the receptor binding domain of Middle East respiratory syndrome coronavirus (MERS-CoV) spike protein
Huijuan WANG ; Wenling WANG ; Jiaming LAN ; Yao DENG ; Wenjie TAN
Chinese Journal of Microbiology and Immunology 2016;36(2):88-92
Objective To prepare and screen out monoclonal antibodies against the receptor bind-ing domain (RBD) of Middle East respiratory syndrome coronavirus ( MERS-CoV) spike ( S) protein in mice. Methods The RBD of MERS-CoV S protein expressed in the insect-baculovirus system was purified and then used to immunize the female BALB/ c mice. The spleen cells collected from the mice were fused with myeloma Sp2 / 0 cells. The positive hybridoma cells were obtained by using limited dilution method. Enzyme-linked immunosorbent assay ( ELISA), Western blot assay and neutralization test based on the MERS-CoV pseudovirus were performed for further screening and identification. Results Twelve strains of hybridoma cells that produced the monoclonal antibodies against RBD of MERS-CoV S protein were screened out. All of the 12 monoclonal antibodies (McAbs) could have specific reaction with the RBD of MERS-CoV S protein as indicated by the results of ELISA. Of the 12 McAbs, two were identified as the immunoglobulin M (IgM) isotype and the rest were IgG1 isotype by using double antibodies sandwich ELISA. Four McAbs including 1F1, 2E4, 3C3 and 3E6 were identified as having neutralizing activity by the neutralization test based on MERS-CoV pseudovirus. Results of the Western blot assay showed that the four McAbs (1F1, 2E4, 3C3 and 3E6) could have specific reaction with the RBD of MERS-CoV S protein, but no cross-reac-tion with that of SARS-CoV S protein. Conclusion Twelve mouse-derived McAbs against the RBD of MERS-CoV S protein were obtained. The prepared hybridoma cells showed the characteristics of high speci-ficity and stability in antibody secretion. Four out of the 12 McAbs were proved to have neutralizing activity.
9.Establishment of an inactivated viral particle-based ELISA for the detection of anti-MERS-CoV anti-bodies
Huijuan WANG ; Wenling WANG ; Jiaming LAN ; Tie SONG ; Wei ZHEN ; Weimin ZHOU ; Changwen KE ; Guizhen WU ; Wenjie TAN
Chinese Journal of Microbiology and Immunology 2016;36(2):93-97
Objective To establish an inactivated viral particle-based ELISA for the detection of antibodies against Middle East respiratory syndrome coronavirus (MERS-CoV) in serum samples collected from a MERS-CoV associated case. Methods Serum samples were collected from 10 newborns and 40 healthy adults. A viral particle-based ELISA was established by using the inactivated MERS-CoV virions as antigen. The levels of IgM and IgG antibodies in the serum samples were detected by the established ELISA and the cut-off values for positive detection were determined. Then the inactivated MERS-CoV virion-based ELISA was used to detect the antibodies against MERS-CoV in 5 serum samples collected from the first im-ported MERS case in China. Results The cut-off values of IgM and IgG antibodies in serum samples for ELISA were determined to be A450 readings of 0. 32 and 0. 42, respectively. The titers of IgM and IgG anti-bodies in serum samples collected at early admission to hospital from the first imported MERS case in China were both 1 ︰ 40. Seroconversion occurred 2 weeks after his admission to hospital with the titers of IgM and IgG reaching to 1 ︰ 320. Conclusion The inactivated MERS-CoV virion-based ELISA was established successfully and could be used for the detection of serum antibodies (IgG and IgM) in MERS associated cases.
10.Cross protective immune responses in mice elicited by prime-boost strategy with a recombinant DNA vaccine and adenoviral 5-based vaccine expressing structural antigens of hepatitis C virus
Yao DENG ; Jie GUAN ; Xiao YIN ; Jiaming LAN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Microbiology and Immunology 2016;36(3):219-223
Objective To investigate the development strategy of novel T cell based vaccine against HCV infection.Methods BALB/c mice were primed with pSCK-based DNA vaccine and boosted with type 5 adenoviral vector-based vaccine, which expressed the structural proteins ( Core, E1 and E2) de-rived from a Chinese HCV patient (genotype 1b, Hebei strain).Enzyme linked immunospot assay (ELIS-POT) and intracellular cytokine staining ( ICS) were used to analyze the elicited antigen-specific immune re-sponses and the efficacy of cross-protection.Results Immunization of mice with the prime-boost vaccination strategy elicited stronger T cell immune responses against multiple HCV antigens than using the DNA vac-cines alone, especially the IFN-γ-secreting T cell responses against E1 protein as indicated by ELISPOT as-say.ICS data indicated that the prime-boost regimen elicited more TNF-α-producing CD4+and IFN-γ-produ-cing CD8+T cells against E1 protein and high levels of IFN-γ-producing CD4+and CD8+T cells against E2 protein in comparison with immunization with DNA vaccines.Moreover, the prime-boost vaccination was ca-pable of eliciting effective cross-protection in a surrogate challenge model based on a recombinant heterolo-gous HCV (JFH1, 2a) vaccinia virus.Conclusion The prime-boost vaccination using DNA and rAd5-based vaccine expressing HCV structural antigens induced significant cellular immune response and cross-protection in mice, suggesting the possibility of using it as a promising T cell based vaccine against HCV in-fection.

Result Analysis
Print
Save
E-mail