1.Predictive Value of Tumor Mutation Burden in Immunotherapy for Lung Cancer.
Huanlan SA ; Kewei MA ; Yong GAO ; Deqiang WANG
Chinese Journal of Lung Cancer 2019;22(6):380-384
The morbidity and mortality of lung cancer is the first in the world, immunotherapy has become a important treatment strategy in addition to chemotherapy, radiotherapy and targeted therapy. In recent years, the US Food and Drug Administration (FDA) has successively approved immunological checkpoint inhibitors as standard programs for non-small cell lung cancer (NSCLC) in second-line or first-line treatment. The National Comprehensive Cancer Network (NCCN) also recommends immunological checkpoint inhibitors as the standard treatment for small cell lung cancer (SCLC). Now, the treatment for lung cancer has entered the era of precision treatment, it is very important to select effective and reliable biomarker for the dominant populations of lung cancer to receive immunotherapy. A large number of researchs indicated that tumor mutation burden (TMB) may be an independent predicted biomarker for immunotherapy, but with limitations. This article reviewed the predictive value of TMB and its limitations in the field of immunotherapy for lung cancer.
Animals
;
Biomarkers
;
metabolism
;
Humans
;
Immunologic Factors
;
administration & dosage
;
Immunotherapy
;
Lung Neoplasms
;
drug therapy
;
genetics
;
metabolism
;
Mutation
;
Tumor Burden
2.New Advances in the Treatment for Small Cell Lung Cancer.
Xiaoxia CUI ; Peng SONG ; Li ZHANG
Chinese Journal of Lung Cancer 2019;22(6):355-362
Small cell lung cancer (SCLC) is a refractory cancer with high degree of malignancy, rapid disease progression, poor prognosis and easy recurrence. In the past 30 years, the traditional treatment of SCLC, mainly chemotherapy and radiotherapy, has not changed significantly, and the effective treatment method for clinical needs is extremely urgent. The rapid development of precision medicine has revealed the molecular biological characteristics of SCLC, so its diagnosis and treatment will into a new era. At present, some studies have shown that anti-angiogenic drugs, immunotherapy and so on have improved the efficacy of SCLC treatment to some extent, and there are more studies on the diagnosis and treatment of SCLC, so a new field of SCLC treatment are coming and bringing more survival benefits to patients. New studies on targeted therapy, anti-angiogenesis drugs and immunotherapy of molecular pathology of SCLC are emerging. This paper reviews the new diagnosis and treatment methods of SCLC to provide new guidance for its clinical treatment.
.
Angiogenesis Inhibitors
;
administration & dosage
;
Animals
;
Humans
;
Immunologic Factors
;
administration & dosage
;
Immunotherapy
;
Lung Neoplasms
;
diagnosis
;
drug therapy
;
Small Cell Lung Carcinoma
;
diagnosis
;
drug therapy
3.Astragalus membranaceus improves therapeutic efficacy of asthmatic children by regulating the balance of Treg/Th17 cells.
Wei WANG ; Qing-Bin LIU ; Wei JING
Chinese Journal of Natural Medicines (English Ed.) 2019;17(4):252-263
Astragalus membranaceus may be a potential therapy for childhood asthma but its driving mechanism remains elusive. The main components of A. membranaceus were identified by HPLC. The children with asthma remission were divided into two combination group (control group, the combination of budesonide and terbutaline) and A. membranaceus group (treatment group, the combination of budesonide, terbutaline and A. membranaceus). The therapeutic results were compared between two groups after 3-month therapy. Porcine peripheral blood mononuclear cells (PBMCs) were isolated from venous blood by using density gradient centrifugation on percoll. The levels of FoxP3, EGF-β, IL-17 and IL-23 from PBMCs and serum IgE were measured. The relative percentage of Treg/Th17 cells was determined using flow cytometry. The main components of A. membranaceus were calycosin-7-O-glucoside, isoquercitrin, ononin, calycosin, quercetin, genistein, kaempferol, isorhamnetin and formononetin, all of which may contribute to asthma therapy. Lung function was significantly improved in the treatment group when compared with a control group (P < 0.05). The efficacy in preventing the occurrence of childhood asthma was higher in the treatment group than the control group (P < 0.05). The levels of IgE, IL-17 and IL-23 were reduced significantly in the treatment group when compared with the control group, while the levels of FoxP3 and TGF-β were increased in the treatment group when compared with the control group (P < 0.05). A. membranaceus increased the percentage of Treg cells and reduced the percentage of Th17 cells. A. membranaceus is potential natural product for improving the therapeutic efficacy of combination therapy of budesonide and terbutaline for the children with asthma remission by modulating the balance of Treg/Th17 cells.
Animals
;
Asthma
;
drug therapy
;
immunology
;
Astragalus propinquus
;
chemistry
;
Budesonide
;
administration & dosage
;
Cells, Cultured
;
Child
;
Child, Preschool
;
Cytokines
;
metabolism
;
Drugs, Chinese Herbal
;
administration & dosage
;
pharmacology
;
Female
;
Humans
;
Immunologic Factors
;
administration & dosage
;
pharmacology
;
Leukocytes, Mononuclear
;
drug effects
;
metabolism
;
Lung
;
drug effects
;
physiology
;
Male
;
Swine
;
T-Lymphocytes, Regulatory
;
cytology
;
drug effects
;
Terbutaline
;
administration & dosage
;
Th17 Cells
;
cytology
;
drug effects
;
Treatment Outcome
4.Effect of methotrexate on regulation for the number of regulatory T cells and expression of Foxp3 in psoriasis.
Yehong KUANG ; Heng ZHANG ; Wu ZHU ; Lisha WU ; Wangqing CHEN ; Yan LU ; Qunshi QIN ; Xuekun JIA ; Liqiu LIAO
Journal of Central South University(Medical Sciences) 2018;43(8):835-842
To explore the role of methotrexate (MTX) in regulating the number of regulatory T cells (Treg) and the mRNA expression of transcription factor Foxp3.
Methods: 1) We analyzed the number of Treg and the mRNA expression of Foxp3 by flow cytometry (FCM) and quantitative real-time PCR (qRT-PCR) respectively in patients with psoriasis vulgaris, patients with psoriasis vulgaris after the 8-week treatment of MTX, and healthy people. 2) BALB/c female mice were smeared with imiquimod (IMQ) cream for 6 days. We recorded the change of the lesion in mice every day. The morphological changes of lesion in mice were evaluated by the psoriasis area and severity index (PASI) and HE staining. 3) The mouse model was randomly divided into a control group and an MTX group. The MTX group was treated with different doses of MTX (38.5 and 77.0 nmol/L) on the third day of this experiment. The morphological changes of lesion in mice were evaluated by PASI and HE staining. We tested the number of Treg and the expression level of Foxp3 mRNA in splenic lymphocytes.
Results: 1) The number of Treg and the expression level of Foxp3 mRNA were lower in psoriasis vulgaris patients than those in the healthy control group (P<0.05). After 8-week treatment of MTX, the number of Treg was increased (P<0.05) and Foxp3 mRNA level was up-regulated (P<0.01). 2) Typical psoriasis-like skin lesions, such as red scaly skin plaque were found after topical application of IMQ. Both the number of Treg in the splenic lymphocytes of mice and the Foxp3 mRNA level of Treg were reduced by IMQ (P<0.01 and P<0.05). 3) Different doses of MTX for mice showed the ability to improve skin lesion, increase the number of Treg in the spleen of mice and Foxp3 mRNA level in psoriatic dermatitis of mice (P<0.05).
Conclusion: MTX is able to regulate the number of Treg and Foxp3 mRNA expression in psoriasis.
Adjuvants, Immunologic
;
pharmacology
;
Aminoquinolines
;
pharmacology
;
Animals
;
Case-Control Studies
;
Female
;
Forkhead Transcription Factors
;
metabolism
;
Humans
;
Imiquimod
;
Immunosuppressive Agents
;
administration & dosage
;
pharmacology
;
Lymphocyte Count
;
Methotrexate
;
administration & dosage
;
pharmacology
;
Mice
;
Mice, Inbred BALB C
;
Psoriasis
;
drug therapy
;
immunology
;
metabolism
;
pathology
;
RNA, Messenger
;
metabolism
;
Random Allocation
;
Spleen
;
cytology
;
T-Lymphocytes, Regulatory
;
cytology
;
drug effects
;
metabolism
5.Evolution of Myelofibrosis Treatment.
Korean Journal of Medicine 2016;90(4):293-297
Myelofibrosis (MF) is a classical Philadelphia chromosome-negative myeloproliferative neoplasm characterized by clonal proliferation of pluripotent stem cells, dysfunctional kinase signaling, and abnormal cytokine release. MF is a heterogeneous disease, ranging from asymptomatic to being associated with one or more of the following problems: profound anemia, splenomegaly, constitutional issues, and even rapid progression to overt leukemia. Recently, important progress has been made. A Janus kinase (JAK) 2 mutation affects both pathogenesis and prognosis. Conventional treatment is primarily palliative and has only limited effects on the natural course of the disease. Allogeneic stem cell transplantation is the only curative treatment, but is presently limited to eligible intermediate-2 and high-risk patients. Ruxolitinib, the first drug approved by the Food and Drug Administration for treatment of intermediate-2 and high-risk patients, is currently the best available therapy for symptomatic MF patients. Additional JAK inhibitors are under investigation. Emerging therapies include immunomodulators and inhibitors of histone deacetylase (HDAC), mammalian target of rapamycin (mTOR), and telomerase. A better understanding of disease pathogenesis will lead to the development of better treatments modifying the disease course and, ultimately, curing the condition.
Anemia
;
Histone Deacetylases
;
Humans
;
Immunologic Factors
;
Leukemia
;
Phosphotransferases
;
Pluripotent Stem Cells
;
Primary Myelofibrosis*
;
Prognosis
;
Sirolimus
;
Splenomegaly
;
Stem Cell Transplantation
;
Telomerase
;
United States Food and Drug Administration
6.Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris.
Wei-Hui LIU ; Yan CHEN ; Xue-Wei BAI ; Hui-Min YAO ; Xu-Guang ZHANG ; Xiu-Wen YAN ; Ren LAI
Chinese Journal of Natural Medicines (English Ed.) 2016;14(9):677-682
The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.
Amino Acid Sequence
;
Animals
;
Immunologic Factors
;
administration & dosage
;
chemistry
;
genetics
;
Inflammation
;
drug therapy
;
immunology
;
Interferon-gamma
;
immunology
;
Interleukin-6
;
immunology
;
Leeches
;
chemistry
;
Mass Spectrometry
;
Mice
;
Molecular Sequence Data
;
Neuropeptide Y
;
administration & dosage
;
chemistry
;
genetics
;
Peptide Mapping
;
Salivary Glands
;
chemistry
;
Tumor Necrosis Factor-alpha
;
immunology
7.Study on anti-inflammation and immunoloregulation effect of Guizhi Fuling capsule ingredients using high content screening.
Yan-ru WANG ; Na LI ; Liang CAO ; Chen-feng ZHANG ; Tuan-jie WANG ; Gang DING ; Zhen-zhong WANG ; Wei XIAO
China Journal of Chinese Materia Medica 2015;40(6):1005-1011
The present study sought to investigate the anti-inflammation and immunoloregulation effect of 17 Guizhi Fuling capsule ingredients. The anti-inflammatory ingredients on LPS-induced RAW264. 7 cell injury were assessed with ELISA and immunofluorescence. The release of IL-1β, TNF-α, PGE2 were detected with ELISA and the expression of COX-2 was detected with immunofluorescence. The effects of them on promoting splenic lymphocyte proliferation were assessed with MTT and Hoechst 33342 staining method. The results showed that 15 ingredients had obviously anti-inflammatory activity on LPS- induced injury and play the immunoloregulation roles. This study suggested that the 15 ingredients may be the active ingredients on pelvic infection.
Animals
;
Anti-Inflammatory Agents
;
pharmacology
;
Capsules
;
pharmacology
;
Cyclooxygenase 2
;
immunology
;
Drugs, Chinese Herbal
;
administration & dosage
;
Immunologic Factors
;
pharmacology
;
Inflammation
;
drug therapy
;
Interleukin-1beta
;
immunology
;
Macrophages
;
drug effects
;
enzymology
;
immunology
;
Male
;
Mice
;
Mice, Inbred BALB C
;
Spleen
;
cytology
;
drug effects
;
immunology
;
Tumor Necrosis Factor-alpha
;
immunology
8.The Effect of Bortezomib on Antibody-Mediated Rejection after Kidney Transplantation.
Juhan LEE ; Beom Seok KIM ; Yongjung PARK ; Jae Geun LEE ; Beom Jin LIM ; Hyeon Joo JEONG ; Yu Seun KIM ; Kyu Ha HUH
Yonsei Medical Journal 2015;56(6):1638-1642
PURPOSE: Recently, bortezomib has been used to treat antibody-mediated rejection (AMR) refractory to conventional treatment such as plasmapheresis, intravenous immunoglobulin, and rituximab. The authors aimed to describe their experiences when bortezomib was used to treat refractory AMR. MATERIALS AND METHODS: Eleven refractory AMR episodes treated with bortezomib were included in this study. The patients received one or two cycles of bortezomib (1.3 mg/m2) on days 1, 4, 8, and 11. RESULTS: Bortezomib effectively reduced antibodies against various targets, including human leukocyte antigen (HLA) class I and II, ABO blood group antigen, and angiotensin II type 1 receptor. Antibodies were depleted or reduced significantly in eight AMR episodes. Overall, there was a significant improvement in the mean estimated glomerular filtration rate (eGFR) at 3 months after therapy (36.91+/-22.15 mL/min/1.73 m2) versus eGFR at time of AMR diagnosis (17.00+/-9.25 mL/min/1.73 m2; p=0.007). All six early-onset AMR episodes (within 6 months post-transplantation) showed full recovery of allograft function. Additionally, three of the five late-onset AMR episodes (>6 months post-transplantation) showed improved allograft function. CONCLUSION: Anti-humoral treatment based on bortezomib might be an effective strategy against refractory AMR caused by various types of antibodies. Notably, this treatment could be more effective in early-onset AMR than in late-onset AMR.
Adolescent
;
Adult
;
Antibodies, Monoclonal/therapeutic use
;
Antineoplastic Agents/*therapeutic use
;
Boronic Acids/therapeutic use
;
Bortezomib/*therapeutic use
;
Female
;
Graft Rejection/*drug therapy/*prevention & control
;
Humans
;
Immunoglobulins, Intravenous/therapeutic use
;
Immunologic Factors/therapeutic use
;
Isoantibodies
;
Kidney Failure, Chronic/*surgery
;
*Kidney Transplantation
;
Male
;
Middle Aged
;
Plasmapheresis
;
Pyrazines/administration & dosage
;
Transplantation, Homologous
9.Experimental study on anti-tumor effect of xihuang pill and its immune clearance function.
Jie MA ; Yi-Yao WANG ; Wei YANG ; Shuo GUAN ; Chang-Qian ZENG ; Wen-Bin GAO ; Wen-Bo LIANG
China Journal of Chinese Materia Medica 2014;39(8):1499-1501
OBJECTIVETo discuss the anti-tumor effect of Xihuang pill on tumor-bearing rats and its effect on the immune clearance function of tumor-bearing organisms.
METHODWalker256 tumor cells were adopted to establish the tumor-bearing rat model. The rats were randomly divided into five groups: the normal control group, the model control group, the lentinan group and Xihuang pill low dose, middle dose and high dose groups, with 10 rats in each group, and continuously treated and given drugs for 14 d after modeling. Blood and tumors were collected from abdominal aorta to calculate the tumor inhibition rate. The content of CD3+, CD4+, CD8+ T cells and adhesion molecule B7-1 (CD80) in peripheral blood were detected by flow cytometry (FCM). The expressions of IL-2 and IFN-gamma in were determined by ELISA.
RESULTThe tumor inhibition rate of the Xihuang pill high dose group was 33. 1 percent. Compared with the model group, the Xihuang pill large dose group showed significantly low IL-2, IFN-gamma, CD3+, CD4+, B7-1 in peripheral blood, with statistical significance in their differences (P < 0.05).
CONCLUSIONXihuang pill could show its anti-tumor effect by enhancing the immune clearance function and increasing IL-2, IFN-gamma, CD3+ T, CD4+ T, B7-1 in peripheral blood.
Animals ; Antineoplastic Agents ; administration & dosage ; B7-1 Antigen ; genetics ; immunology ; Breast Neoplasms ; drug therapy ; genetics ; immunology ; CD4-Positive T-Lymphocytes ; drug effects ; immunology ; Drugs, Chinese Herbal ; administration & dosage ; Female ; Flow Cytometry ; Humans ; Immune System ; drug effects ; Immunologic Factors ; administration & dosage ; Interferon-gamma ; genetics ; immunology ; Interleukin-2 ; genetics ; immunology ; Rats ; Rats, Wistar ; Tumor Burden ; drug effects
10.Clinical Outcomes of Initial Dexamethasone Treatment Combined with a Single High Dose of Intravenous Immunoglobulin for Primary Treatment of Kawasaki Disease.
Yonsei Medical Journal 2014;55(5):1260-1266
PURPOSE: To investigate the clinical effects of a single high dose intravenous immunoglobulin (IVIG) combined with initial dexamethasone as a primary treatment on Kawasaki disease (KD). MATERIALS AND METHODS: Between January 2008 and December 2010, we reviewed the medical records of 216 patients with complete KD patients that were admitted to a single medical center. 106 patients were treated with a single high dose of IVIG (2 g/kg) alone and 110 patients received IVIG and dexamethasone (0.3 mg/kg per day for three days). RESULTS: The combined IVIG plus dexamethasone patient group had a significantly shorter febrile period and duration of hospital stay (1.4+/-0.7 days vs. 2.0+/-1.2 days, p<0.001; 5.8+/-1.7 days vs. 6.9+/-2.5 days, p<0.001, respectively) than the IVIG alone group. The combined IVIG plus dexamethasone group required IVIG retreatment significantly less than the IVIG only group (12.7% vs. 32%, p=0.003). After completion of the initial IVIG, C-reactive protein levels in the combined IVIG plus dexamethasone group were significantly lower than those in the IVIG only group (2.7+/-4.0 mg/dL vs. 4.6+/-8.7 mg/dL, p=0.03). In the combined IVIG plus dexamethasone group, the incidence of coronary artery lesions tended to be lower without worse outcomes at admission after initial infusion of IVIG and in follow-up at two months; however, the differences were not significant (8.2% vs. 11.3%, p=0.22; 0.9% vs. 2.8%, p=0.29). CONCLUSION: Initial combined therapy with dexamethasone and a single high-dose of IVIG resulted in an improved clinical course, in particular a shorter febrile period, less IVIG retreatment, and shorter hospital stay without worse coronary outcomes.
Child, Preschool
;
Dexamethasone/administration & dosage/adverse effects/*therapeutic use
;
Female
;
Fever/drug therapy
;
Glucocorticoids/administration & dosage/adverse effects/*therapeutic use
;
Humans
;
Immunoglobulins, Intravenous/administration & dosage/adverse effects/therapeutic use
;
Immunologic Factors/administration & dosage/adverse effects/*therapeutic use
;
Infant
;
Length of Stay
;
Male
;
Mucocutaneous Lymph Node Syndrome/*drug therapy
;
Treatment Outcome

Result Analysis
Print
Save
E-mail