1.Analysis of false-negative cases by Optical genome mapping and a literature review.
Junrong ZHANG ; Min SU ; Yuquan ZHANG ; Jianlin ZHANG
Chinese Journal of Medical Genetics 2025;42(11):1288-1294
OBJECTIVE:
To explore the reasons for false negative results by Optical genome mapping (OGM) analysis of three cases and propose strategies for handling them.
METHODS:
Three patients presented at the Affiliated Hospital of Nantong University between July 2022 and July 2024 were selected as study subjects. The patients included a 37-year-old female with two miscarriages, a 1.5-year-old boy with delayed motor development, and a 35-year-old male whose son had intellectual disability. The patients had undergone comprehensive evaluation with chromosomal karyotyping analysis, single nucleotide polymorphism microarray (SNP array) assay, fluorescence in situ hybridization (FISH), and methylation-specific multiple ligation-dependent probe amplification (MS-MLPA). A retrospective analysis was also carried out on the results of OGM testing. This study was approved by the Medical Ethics Committee of the Hospital (Ethics No.: 2020-K004).
RESULTS:
The chromosomal karyotype of patient 1 was 46,XX,4qs, and no abnormality was found by SNP array, FISH, and OGM testing. Patient 2 had a normal chromosomal karyotype, and SNP array analysis did not reveal any copy number abnormalities of chromosomal fragments but the presence of a homozygous region of approximately 79.58 Mb at 15q11.2-q26.3 (chr15: 22817871_102397317). MS-MLPA detection indicated that the copy number of the 15q11.2-q13 region was 2, and the degree of methylation was relatively high (average ratio = 1.0). OGM detection confirmed the presence of approximately 67.97 Mb of homozygosity in the chr15:33814680_101787650 [hg38] region of 15q14-q26.3. Patient 3 had a chromosomal karyotype of 46,XY,t(9;14)(q13;q11.2). No abnormality was found by OGM testing for patients 1 and 3.
CONCLUSION
As a novel cytogenetic technique, OGM can achieve high-resolution and high-precision analysis for numerical and structural genomic abnormalities. Nevertheless, it also has certain limitations, as its false negative results are related to factors such as the type of genomic variation, the chromosomal regions involved in the variation, the type of disease, and the version of human reference genome. Currently, it cannot be used as an independent method for the diagnosis of genetic diseases.
Humans
;
Male
;
Female
;
Adult
;
Polymorphism, Single Nucleotide/genetics*
;
Karyotyping
;
Chromosome Mapping/methods*
;
Infant
;
False Negative Reactions
;
In Situ Hybridization, Fluorescence
2.Whole-Brain Mapping of Direct Inputs to and Axonal Projections from GABAergic Neurons in the Parafacial Zone.
Yun-Ting SU ; Meng-Yang GU ; Xi CHU ; Xiang FENG ; Yan-Qin YU
Neuroscience Bulletin 2018;34(3):485-496
The GABAergic neurons in the parafacial zone (PZ) play an important role in sleep-wake regulation and have been identified as part of a sleep-promoting center in the brainstem, but the long-range connections mediating this function remain poorly characterized. Here, we performed whole-brain mapping of both the inputs and outputs of the GABAergic neurons in the PZ of the mouse brain. We used the modified rabies virus EnvA-ΔG-DsRed combined with a Cre/loxP gene-expression strategy to map the direct monosynaptic inputs to the GABAergic neurons in the PZ, and found that they receive inputs mainly from the hypothalamic area, zona incerta, and parasubthalamic nucleus in the hypothalamus; the substantia nigra, pars reticulata and deep mesencephalic nucleus in the midbrain; and the intermediate reticular nucleus and medial vestibular nucleus (parvocellular part) in the pons and medulla. We also mapped the axonal projections of the PZ GABAergic neurons with adeno-associated virus, and defined the reciprocal connections of the PZ GABAergic neurons with their input and output nuclei. The newly-found inputs and outputs of the PZ were also listed compared with the literature. This cell-type-specific neuronal whole-brain mapping of the PZ GABAergic neurons may reveal the circuits underlying various functions such as sleep-wake regulation.
Animals
;
Axons
;
physiology
;
Brain
;
anatomy & histology
;
Brain Mapping
;
Brain Stem
;
cytology
;
GABAergic Neurons
;
physiology
;
Green Fluorescent Proteins
;
genetics
;
metabolism
;
Mice
;
Mice, Inbred C57BL
;
Mice, Transgenic
;
Neural Pathways
;
physiology
;
Peptide Elongation Factor 1
;
genetics
;
metabolism
;
Rabies virus
;
genetics
;
metabolism
;
Transduction, Genetic
;
Vesicular Inhibitory Amino Acid Transport Proteins
;
genetics
;
metabolism
3.Helicobacter pylori Antigens Inducing Early Immune Response in Infants.
Ji Hyun SEO ; Jong Hyuk YOUN ; Eun A KIM ; Jin Su JUN ; Ji Sook PARK ; Jung Sook YEOM ; Jae Young LIM ; Hyang Ok WOO ; Hee Shang YOUN ; Gyung Hyuck KO ; Jin Sik PARK ; Seung Chul BAIK ; Woo Kon LEE ; Myung Je CHO ; Kwang Ho RHEE
Journal of Korean Medical Science 2017;32(7):1139-1146
To identify the Helicobacter pylori antigens operating during early infection in sera from infected infants using proteomics and immunoblot analysis. Two-dimensional (2D) large and small gel electrophoresis was performed using H. pylori strain 51. We performed 2D immunoglobulin G (IgG), immunoglobulin A (IgA), and immunoglobulin M (IgM) antibody immunoblotting using small gels on sera collected at the Gyeongsang National University Hospital from 4–11-month-old infants confirmed with H. pylori infection by pre-embedding immunoelectron microscopy. Immunoblot spots appearing to represent early infection markers in infant sera were compared to those of the large 2D gel for H. pylori strain 51. Corresponding spots were analyzed by matrix-assisted laser desorption/ionization time of flight-mass spectrometry (MALDI-TOF-MS). The peptide fingerprints obtained were searched in the National Center for Biotechnology Information (NCBI) database. Eight infant patients were confirmed with H. pylori infection based on urease tests, histopathologic examinations, and pre-embedding immunoelectron microscopy. One infant showed a 2D IgM immunoblot pattern that seemed to represent early infection. Immunoblot spots were compared with those from whole-cell extracts of H. pylori strain 51 and 18 spots were excised, digested in gel, and analyzed by MALDI-TOF-MS. Of the 10 peptide fingerprints obtained, the H. pylori proteins flagellin A (FlaA), urease β subunit (UreB), pyruvate ferredoxin oxidoreductase (POR), and translation elongation factor Ts (EF-Ts) were identified and appeared to be active during the early infection periods. These results might aid identification of serological markers for the serodiagnosis of early H. pylori infection in infants.
Biotechnology
;
Electrophoresis
;
Flagellin
;
Gels
;
Helicobacter pylori*
;
Helicobacter*
;
Humans
;
Immunoblotting
;
Immunoglobulin A
;
Immunoglobulin G
;
Immunoglobulin M
;
Infant*
;
Microscopy, Immunoelectron
;
Peptide Elongation Factors
;
Peptide Mapping
;
Proteomics
;
Pyruvate Synthase
;
Serologic Tests
;
Spectrum Analysis
;
Urease
4.Screening of Serum Markers in Primary Immune Thrombocytopenia.
Yang ZHANG ; Ju BAI ; Wang-Gang ZHANG ; Ai-Li HE
Journal of Experimental Hematology 2016;24(3):788-794
OBJECTIVETo analyze the serum protein fingerprints of immune thrombocytopenia (ITP) patients and healthy controls by using weak cation exchange nanometer magnetic beads and MALDI-TOF-MAS technology, to identify the proteins with different expression, to establish the diagnostic model for ITP and to explore the pathogenesis of ITP.
METHODSA total of 40 patients with ITP and 40 healthy controls were selected, the serum protein components were captured by using weak cation exchange nanaometer magnetic beads, the protein spectra of all specimens were detected by Autoflex II matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI- TOF-MS) and then the data were analyzed by CliprotoolsTM2.2 software, by which the distinct protein molecules were screened to set up ITP diagnostic model. To identify the established model, the sera of 20 ITP patients and 20 healthy controls were selected to make category and cross validations.
RESULTSThe detection of Clinprot system and the analysis of CliprotoolsTM2.2 software showed that about 55 protein peaks were detected with the range of 700 Da to 10 000 Da of molecular weight in the protein spectrum of serum speciments from 40 ITP patients and 40 healthy controls. Compared with healthy controls, 19 protein expression peaks with statistically significant difference were found in ITP patients (P < 0.05), among them 5 expressions were up-regulated and 14 expressions were down-regulated. The diagnostic model on basis of Supervised Neural Network Algorithm (SNN) was established through 10 MS peaks with strongest capability in ITP group and control group automatically distinguished by software, and it is expected that the sensitivity of model group reached to 100%, and the specificity to 100%. The category validation showed that this diagnostic model correctly identificed all 20 ITP patients and 20 healthy controls, and in cross validation, the model sensitivity was 100% and the specificity was 100%.
CONCLUSIONThe ITP SNN model ertablished by using ChinProt System with high flax and good repetition is composed of 10 protein peaks with significant difference, this model can effectively distinguish ITP patients and healthy controls.
Biomarkers ; blood ; Blood Proteins ; analysis ; Case-Control Studies ; Humans ; Molecular Weight ; Neural Networks (Computer) ; Peptide Mapping ; Proteomics ; Purpura, Thrombocytopenic, Idiopathic ; blood ; Sensitivity and Specificity ; Software ; Spectrometry, Mass, Matrix-Assisted Laser Desorption-Ionization
5.Structural characterization and analysis of Omalizumab and its biosimilar CMAB007 by LC-MS.
Jun XU ; Dapeng ZHANG ; Hao WANG ; Huaizu GUO
Chinese Journal of Biotechnology 2016;32(4):497-506
We compared the similarity of Omalizumab (Xolair; a humanized anti-immunoglobulin E monoclonal antibody) and it's biosimilar CMAB007. An in depth characterization of a candidate biosimilar was carried out using a systematic approach, the approach provides a set of routine tools that combine accurate intact mass measurement, peptide mapping, and released glycan profiling. CMAB007 and Omalizumab had the same primary structure and exhibited almost the same content of C-terminal lysine variants. The types of detected free oligosaccharides were very similar, such as sialylation, fucosylation and high mannose types. CMAB007 could be considered as a highly similar molecular to Omalizumab and expected to be the first humanized anti-immunoglobulin E monoclonal antibody drug in China.
Biosimilar Pharmaceuticals
;
chemistry
;
Chromatography, Liquid
;
Glycosylation
;
Humans
;
Mannose
;
chemistry
;
Mass Spectrometry
;
Omalizumab
;
chemistry
;
Peptide Mapping
;
Polysaccharides
;
chemistry
6.Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris.
Wei-Hui LIU ; Yan CHEN ; Xue-Wei BAI ; Hui-Min YAO ; Xu-Guang ZHANG ; Xiu-Wen YAN ; Ren LAI
Chinese Journal of Natural Medicines (English Ed.) 2016;14(9):677-682
The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.
Amino Acid Sequence
;
Animals
;
Immunologic Factors
;
administration & dosage
;
chemistry
;
genetics
;
Inflammation
;
drug therapy
;
immunology
;
Interferon-gamma
;
immunology
;
Interleukin-6
;
immunology
;
Leeches
;
chemistry
;
Mass Spectrometry
;
Mice
;
Molecular Sequence Data
;
Neuropeptide Y
;
administration & dosage
;
chemistry
;
genetics
;
Peptide Mapping
;
Salivary Glands
;
chemistry
;
Tumor Necrosis Factor-alpha
;
immunology
7.Expression of prolyl 4-hydroxylase beta-polypeptide in non-small cell lung cancer treated with Chinese medicines.
Shu-mei WANG ; Li-zhu LIN ; Dai-han ZHOU ; Jing-xu ZHOU ; Shao-quan XIONG
Chinese journal of integrative medicine 2015;21(9):689-696
OBJECTIVESTo investigate the role of prolyl 4-hydroxylase beta polypeptide (P4HB) expressed in lung carcinoma and the intervention effect of Yiqi Chutan Formula (, YQCTF).
METHODSLung carcinoma model was established by subcutaneously inoculating LEWIS lung carcinoma cells in C57BL/6J mice. The differential expression of P4HB protein between the YQCTF (3.0 g/kg, gavage, once daily, 21 days) group and the control group was acquired by a 2 fluorescence difference gel electrophoresis (2D-DIGE), verified by Western blotting and identified by matrix-assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF/TOF-MS). The expression of P4HB and P4HB mRNA in cultured A549 cells from cisplatin (DDP) 1.5 µg/mL group and 15% serum combined with DDP 1.5 µg/mL group were detected by cellular immunohistochemistry and reverse transcription-polymerase chain reaction, respectively.
RESULTSThe proteomics research discovered that one-third of differential proteins including P4HB were decreased in the YQCTF group (P<0.01). Clinical pathology and tissue microarray studies showed that P4HB expression in lung cancer tissue was stronger than adjacent tissues and normal lung epithelial (P<0.01). In the YQCTF and DDP combined groups, the expression of P4HB and P4HB mRNA in A549 cell were decreased significantly (P<0.01).
CONCLUSIONYQCTF could inhibit the LEWIS lung carcinoma's growth, decrease the expression of P4HB in LEWIS lung carcinoma and A549 cells. YQCTF might take effect through regulating P4HB in endoplasmic reticulum to inhibit the incidence and growth process of lung carcinoma.
Animals ; Blotting, Western ; Carcinoma, Non-Small-Cell Lung ; drug therapy ; genetics ; pathology ; Cell Line, Tumor ; Cell Proliferation ; drug effects ; Disease Progression ; Drugs, Chinese Herbal ; pharmacology ; therapeutic use ; Electrophoresis, Gel, Two-Dimensional ; Gene Expression Regulation, Neoplastic ; drug effects ; Immunohistochemistry ; Lung Neoplasms ; drug therapy ; genetics ; pathology ; Mice, Inbred C57BL ; Peptide Mapping ; Peptides ; pharmacology ; therapeutic use ; Prolyl Hydroxylases ; genetics ; metabolism ; Proteomics ; RNA, Messenger ; genetics ; metabolism ; Real-Time Polymerase Chain Reaction ; Tissue Array Analysis
8.Characterization and comparison of interferon reference standards using UPLC-MS.
Lei TAO ; De-ning PEI ; Chun-mei HAN ; Wei CHEN ; Chun-ming RAO ; Jun-zhi WANG
Acta Pharmaceutica Sinica 2015;50(1):75-80
The study aims to characterize and compare interferon reference standards from 5 manufacturers. By testing molecular mass and trypsin-digested peptide mass mapping, the amino acid sequence was verified and post-translational modifications such as disulfide bond were identified. Results show that the molecular mass and amino acid sequence were consistent with theory; the disulfide bonds of 4 lots of interferon were Cys1-Cys98/Cys29-Cys138, 1 lot was Cys29-Cys139/Cys86-Cys99; N-terminal "+Met", acetyl N-terminal and Met oxidation were identified in part of the sample. UPLC-MS can be used to characterize and compare interferon reference standards from different manufacturers.
Amino Acid Sequence
;
Chromatography, High Pressure Liquid
;
methods
;
Interferons
;
standards
;
Mass Spectrometry
;
methods
;
Molecular Weight
;
Oxidation-Reduction
;
Peptide Mapping
;
Protein Processing, Post-Translational
;
Reference Standards
9.Rapid and high-throughput identification of recombinant bacteria with mass spectrometry assay.
Di XIAO ; Xiao Xia TAO ; Peng WANG ; Guo Dong LIU ; Ya Nan GONG ; Hui Fang ZHANG ; Hai Bin WANG ; Jian Zhong ZHANG ;
Biomedical and Environmental Sciences 2014;27(4):250-258
OBJECTIVETo construct a rapid and high-throughput assay for identifying recombinant bacteria based on mass spectrometry.
METHODSMatrix assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF MS) techniques were used to identify 12 recombinant proteins (10 of Yersinia pestis, 1 of Campylobacter jejuni and 1 of Helicobacter pylori). A classification model for the various phase of recombinant bacteria was established, optimized and validated, using MALDI-TOF MS-ClinProTools system. The differences in the peptide mass spectra were analyzed by using Biotyper and FlexAnalysis softwares.
RESULTSModels of GA, SNN, and QC were established. After optimizing the parameters, the GA recognition model showed good classification capabilities: RC=100%, mean CVA=98.7% (the CVA was 96.4% in phase 1, 100% in phase 2, 98.4% in phase 3, and 100% in phase 4, respectively) and PPV=95%. This model can be used to classify the bacteria and their recombinant, which only requires 3.7×103 cells for analysis. The total time needed is only 10 min from protein extraction to reporting the result for one sample. Furthermore, this assay can automatically detect and test 96 samples concurrently. A total of 48 specific peaks (9, 16, 9, and 14 for the four stages, respectively) was found in the various phase of recombinant bacteria.
CONCLUSIONMALDI-TOF MS can be used as a fast, accurate, and high-throughput method to identify recombinant bacteria, which provide a new ideas not only for recombinant bacteria but also for the identification of mutant strains and bioterrorism pathogens.
Bacterial Proteins ; analysis ; Cloning, Molecular ; Escherichia coli ; Mass Spectrometry ; Organisms, Genetically Modified ; Peptide Mapping ; Recombinant Proteins ; analysis
10.An antibody reactive to the Gly63-Lys68 epitope of NT-proBNP exhibits O-glycosylation-independent binding.
Yujean LEE ; Hyori KIM ; Junho CHUNG
Experimental & Molecular Medicine 2014;46(9):e114-
The N-terminal fragment of prohormone brain natriuretic peptide (NT-proBNP) is a commonly used biomarker for the diagnosis of congestive heart failure, although its biological function is not well known. NT-proBNP exhibits heavy O-linked glycosylation, and it is quite difficult to develop an antibody that exhibits glycosylation-independent binding. We developed an antibody that binds to the recombinant NT-proBNP protein and its deglycosylated form with similar affinities in an enzyme immunoassay. The epitope was defined as Gly63-Lys68 based on mimetic peptide screening, site-directed mutagenesis and a competition assay with a peptide mimotope. The nearest O-glycosylation residues are Thr58 and Thr71; therefore, four amino acid residues intervene between the epitope and those residues in both directions. In conclusion, we report that an antibody reactive to Gly63-Lys68 of NT-proBNP exhibits O-glycosylation-independent binding.
Amino Acid Sequence
;
Animals
;
Antibodies/*immunology
;
Antigen-Antibody Reactions
;
Epitope Mapping
;
Epitopes/chemistry/genetics/*immunology
;
Glycosylation
;
HEK293 Cells
;
Heart Failure/immunology
;
Humans
;
Molecular Sequence Data
;
Mutagenesis, Site-Directed
;
Natriuretic Peptide, Brain/chemistry/genetics/*immunology
;
Peptide Fragments/chemistry/genetics/*immunology
;
Rabbits
;
Recombinant Fusion Proteins/chemistry/genetics/immunology

Result Analysis
Print
Save
E-mail