1.Biomechanical study of improved memory alloy embracing fixators in treatment of periprosthetic femoral fracture due to hip arthroplasty
Qiang SUN ; Yao LU ; Hongxun WANG ; Shuai XIANG
Chinese Journal of Trauma 2015;31(7):637-640
Objective To study the mechanics of improved memory alloy fixators for salvage of periprosthetic femoral fracture (PFF) after hip arthroplasty in the elderly.Methods Thirty countrymen fresh cadaveric femurs with no pathological defect,fracture,deformity or tumor were randomly divided into experimental group and control group with 15 femurs in each according to the random number table.A model of Vancouver type B1 periprosthetic femoral fracture following hip arthroplasty was induced.The fracture was treated with modified memory alloy embracing fixators in experimental group;instead general memory alloy embracing fixators in control group.All specimens were tested biomechanically.Results Under the same mechanical loading,the two groups showed respective 30% and 48% maximum differences in stress value and displacement.Results in three-point bending test did not differ significantly between the two groups (P > 0.05),but there were significant differences in axial compression and torsion test (P < 0.05 or 0.01).Conclusion The improved memory alloy embracing fixators present better resistance to compression and torsion compared to the general fixators.
2.Study between related factors of hepatocellular carcinoma and ubiquitin proteasome pathway
Shuai WANG ; Liang CHU ; Xiaowei HU ; Jihong YAO
Chinese Journal of Clinical Pharmacology and Therapeutics 2004;0(09):-
Hepatocellular carcinoma is one of the largest causes of cancer-related deaths worldwide for which there are very limited effective treatment options.The ubiquitin-proteasome pathway(UPP) has rapidly become acknowledged as both critical mechanism for cellular biological function and a latent target of regulation of cancer-related disease.This review focus on the role of ubiquitin-proteasome pathway in hepatocellular carcinoma and its correlation factors(HBV、P27、NF-?B,et al),in order to find novel therapeutic interventions against the genesis and development of hepatocellular carcinoma.
3.Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice.
Jiaming LAN ; Shuai LU ; Yao DENG ; Bo WEN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Virology 2016;32(1):77-81
Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.
Animals
;
Antibodies, Viral
;
immunology
;
Computational Biology
;
Coronavirus Infections
;
immunology
;
prevention & control
;
virology
;
Female
;
Humans
;
Immunization
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
immunology
;
Peptides
;
administration & dosage
;
genetics
;
immunology
;
Spike Glycoprotein, Coronavirus
;
administration & dosage
;
genetics
;
immunology
;
Viral Vaccines
;
administration & dosage
;
genetics
;
immunology
4.Preoperative management of cardiac surgery with glucose-6-phosphate dehydrogenase deficiency
Hai-yong, WANG ; Yi-yao, JIANG ; Wen-bin, ZHANG ; Jian-fei, SONG ; Shuai-zhou, LIU
Chinese Journal of Endemiology 2011;30(6):691-693
Objective To observe the perioperative management of cardiac surgery and extracorporeal circulation method in patients with glucose-6-phosphate dehydrogenase deficiency(G6PD).Methods Ten patients with G6PD deficiency underwent uneventful cardiac surgery procedures between January 2005 and December 2010.Twenty patients who had non-G6PD deficiency were as a control group,the selected conditions were the same gender,age,body mass,the risk of heart disease surgery.The preoperative management in patients with G6PD deficiency mainly focused on avoiding the drugs implicated in haemolysis,reducing the surgical stress,using moderate hypothermia extracorporeal circulation and enhancing blood conservation.Observed indicators included the assisted ventilation time,urine volume,the drainage volume of chest tube,the amount transfusion of red blood cells and plasma,the level of hemoglobin and serum total bilirubin in the 2nd day after surgery,ICU stay.Results Compared with the control group,patients with G6PD deficiency had no significant difference in duration of ventilation after the operation,drainage,urine,Hgb,bilirubin levels,and blood transfusion[(9.3 ± 4.5)h vs (8.6 ± 5.7)h,(2100 ±670)ml vs (1950 ± 490) ml,(253 ± 146)ml vs (260 ± 120)ml,(1.3 ± 1.0)U vs (1.8 ± 1.2)U,(96 ± 25)g/L vs (99 ± 12)g/L,and (24 ± 8)μmol/L vs (27 ± 1 l)μmol/L,t =0.978,2.032,1.257,0.891,2.182,2.271,and 1.329,all P > 0.05].The duration of ICU discharge was significantly longer in the glucose-6-phosphate dehydrogenase deficient group[ (2.6 ± 0.6)d vs (1.8 ± 1.5)d,t =2.704,P < 0.05].Conclusions Cardiac surgery can be performed safely in patients with G6PD deficiency with enhanced perioperative management.
5.Study of hCTGF Repair on Bone Injury
Ming SUN ; Zhang-Long HE ; Jing-Jing WANG ; Shuai-Yao LU ; Li-Chun WANG ; Yuan ZHAO ; Qi-Han LI ;
China Biotechnology 2006;0(11):-
Object: To study the proliferation of hCTGF on cells and its biological function on bone injury healing.Methods: The fibroblast with potential differentiation was transfected by eukaryotic gene delivery system and then transferred into the experimental animal model with bone fracture.The data were collected by molecular biological and clinical orthopedic technique detection analysis.Results: The results demonstrated an obvious proliferation of hCTGF on cells,suggesting that hCTGF have the biological activity of repairing bone injury via gene therapy.The results provide a new activity factor and treatment approach for bone injury in clinics.
6.Application of third party testing in information system construction of Sichuan grass-root medical and health institutions
Minghui SHEN ; Changqi FENG ; Li FENG ; Yunpeng MAO ; Ren DENG ; Shuai WANG ; Jiefeng WU ; Xin YAO ; Zhihua YU
Chinese Journal of Medical Library and Information Science 2014;(3):15-18,22
After a description of the background and ideas to introduce the third party testing in information system construction of Sichuan grass-root medical and health institutions and the specific working contents of third party testing team, the problems to which importance should be attached in information system construction were analyzed with suggestions put forward for their solution .
7.Analysis of multiple factors to predict the stone free rate of flexible ureteroscopic lithotripsy and the clinical significance of stone-free index model
Weiwen YU ; Xiang HE ; Jiong YAO ; Mi ZHOU ; Shuai WANG ; Guodong LIAO ; Yuelong ZHANG ; Baiye JIN ; Dahong ZHANG
Chinese Journal of Urology 2015;(6):423-428
Objective To analyze the related factors that influence the stone free rate ( SFR) in flexible ureteroscopic lithotripsy ( FURL ) and develop a stone free index ( SFI ) model to estimate and predict the outcome of FURL.Methods A total of 393 patients receiving FURL were included in this study from May 2013 to August 2014.All patients′and calculous characteristics were recorded.It was evaluated the correlation of one-stage SFR with body mass index, the degree of hydronephrosis, the sterile urine, the renal insufficiency, the stone location, the stone number, the cumulative stone diameter ( CSD) , the stone density, the average of CT values, the minimum angle of pelvis ureter long axis with lamp long axis, the average length of stone located calyx-neck, and the minimum ratio of stone located calyx-neck′width with calyx′width.Multivariate regression analysis was used to analyze the relationship between preoperative characteristics and the SFR.Results The one-stage postoperative SFR in our study was 92.4% ( 363/393).We found that the staghorn stone, bacteriuria, CSD, average of CT values, the average length of stone located calyx-neck, the minimum ratio of stone located calyx-neck′width with calyx′width were significantly correlated with the postoperative SFR ( P <0.05 ) .We used logistic regression analysis to determine statistical significant variables and to create predictable mathematical model.The SFI system was consist of four stone characteristics, including the staghorn stone, the cumulative stone diameter, the average length of stone located calyx-neck, and the minimum ratio of stone located calyx-neck′width with calyx′width.The SFI had a high ROC curve (AUC=0.867) for predicting the one-stage postoperative stone free outcome.SFI score >7.5 meant a relatively high SFR ( SFR>85%) of FURL.Conclusions A SFI model using preclinical data was developed to predict the postoperative outcome of FURL, as well as the one-stage SFR.This model needs further prospective studies in the future.
8.Ancient understanding and the method analysis of combined acupuncture and medication.
Yao-shuai WANG ; Ling-ling WANG ; Jian-bin ZHANG ; Ren-shou CHEN
Chinese Acupuncture & Moxibustion 2009;29(3):235-238
To study and analyze on the understanding of ancient physicians' experience about combined acupuncture and medication, the thought of combined acupuncture and medication in ancient Chinese medicine, and the concrete application are analyzed by reorganization of the treatises and literature of ancient physicians. It is found that physicians of past dynasties have the greatest esteem for such academic thought of combined acupuncture and medication as essential quality of physicians, and accumulate rich experience and understanding in the application rules of clinical treatment model of combined acupuncture and medication, and action characteristics of acupuncture and medical herbs, etc. which are worthy to be further studied, so as to better guide clinical practice and scientific researches.
Acupuncture Therapy
;
history
;
methods
;
China
;
Combined Modality Therapy
;
Drug Therapy
;
history
;
methods
;
Drugs, Chinese Herbal
;
therapeutic use
;
History, Ancient
;
Humans
;
Medicine, Chinese Traditional
;
history
;
methods
9.Improving glucose intolerance linked with the reduction of cardiovascular disease events and mortality in a Da Qing population with pre-diabetes-a 20 year follow-up study
Jinping WANG ; Bo ZHANG ; Yayun JIANG ; Ying SHUAI ; Yali AN ; Hui LI ; Chunqin LI ; Yao WANG ; Qiuhong GONG ; Jingjing ZHANG ; Hongliang LI ; Yinghua HU ; Wenying YANG ; Guangwei LI
Chinese Journal of Endocrinology and Metabolism 2010;26(1):6-9
Objective To investigate if improving or slowing the progression of glucose intolerance might be linked with the reduction of cardiovascular disease(CVD)events and mortality in a Da Qing population with prediabetes.Methods In 1986,577 subjects with impaired glucose tolerance in 33 clinics in Daqing city were randomly assigned to either the control group or one of three lifestyle intervention groups(diet,exercise,or diet plus exercise)to receive a 6 year lifestyle intervention.All the participants were followed for 14 years(1993-2006)after completion of the 6 year active interventions to assess the long-term effect of the interventions.In this post-hoc analysis,the participants were stratified into four subgroups(quartiles)based on their 2 h plasma glucose(2hPG)level after glucose loading at the end of the active intervention,in order to analyze the impact of plasma glucose level on CVD events and mortality.Results During the 20-year follow-up,there were a total of 142 deaths(68 of which were attributed to CVD)and 211 first CVD events(145 strokes and 66 myocardial infarctions).From the highest to the lowest levels of 2hPG in the 4 quartiles,the all-cause mortality(17.8,12.7,10.9,and 9.7/1 000 personyears),CVD mortality(9.1,5.9,6.1,and 4.9/1 1300 person-years)and the incidence of first CVD events(30.4.24.0,18.8,and 19.7/1 000 person-years)showed a clear trend of decline.In multivariate analyses,controlled for age,sex,body mass index,smoking habit,blood pressure,and intervention methods at baseline,the results showed that the 5 mmol/L elevation of 2hPG level after glucose loading in 1992 significantly increased the all-cause mortality(HR 1.335.P=0.005),the incidences offirst CVD events(HR 1.227,P=0.012)and stroke(HR 1.213,P=0.026).Conclusion In pre-diabetes population.if the lifestyle intenrentions are substantially efficacious in improving glucose intolerance,the CVD risk and mortality will be reduced.
10.Effects of Moxibustion at Different Temperatures on Blood Lipids and TRPV1 mRNA in Dorsal Root Ganglion with Hyperlipidemia Rats
ying Gui WANG ; shuai Yao WANG ; yun Jian GAO ; fang Fang SU ; yang Ruo CHEN
Chinese Journal of Information on Traditional Chinese Medicine 2017;24(11):44-47
Objective To compare the effects of moxibustion at different temperatures on blood lipid and TRPV1 in dorsal root ganglion with hyperlipidemia rats; To verify the correlation between efficacy of adjusting fat of moxibustion with activating of TRPV1. Methods The rat model of hyperlipidemia was made by high fat diet. 60 SD mice were randomly divided into four groups: control group, model control group, the 38 ℃ moxibustion group and the 45 ℃ moxibustion group, with 15 mice in each group. Acupoints Shenque and Zusanli were chosen under moxibustion for 10 minutes each time, once another day, for 4 weeks, in the 38 ℃ moxibustion group and the 45 ℃moxibustion group. Blood was taken after intervention, and blood TC, TG, LDL-C and HDL-C of the mice were detected by oxidase method; the dorsal root ganglion was taken to detect the expression of TRPV1 mRNA by real-time fluorescence quantitative PCR. Results Compared with model group, blood lipid indexes in moxibustion groups had different changes, with statistical significance compared with 45 ℃ moxibustion group (P<0.05, P<0.01), and there was statistical significance between 38 ℃ moxibustion group and 45 ℃ moxibustion group (P<0.01); there was statistical significance in TRPV1 mRNA of dorsal root ganglion among 45 ℃ moxibustion group and other three groups (P<0.01). Conclusion The correlation between efficacy of adjusting fat of moxibustion with activating of TRPV1 has been confirmed.