1.Survey on value factors influencing the quality of medical Joint-PhD education: from the angle of Baldrige Performance Excellence program
Xinyi WANG ; Shuang CUI ; Liping DUAN
Chinese Journal of Medical Education Research 2017;16(8):768-771
Objective Joint-PhD program is an effective way to cultivate international creative talents.Survey on intrinsic value factors of this mode is significant to improve the quality of medical education.Methods According to the questionnaire results and reports of 104 medical doctorates who attended the Joint-PhD program in PUHSC,Baldrige Performance Excellence was taken as theoretical framework.Results It showed that index influencing the quality of Joint-PhD education include social responsibility;stakeholders' expectation and market requirements;information and knowledge management support and so on.Conclusion In the process of doctoral education,advocating value of social responsibility,paying attention to the expectations of stakeholders,and attaching importance to the validity of education management services help to understand the intrinsic value of the quality management from the top universities in the world,in order to fundamentally improve the quality of doctoral education.
2.Investigation of Sleep Quality in Patients with Primary Angle-closure Glaucoma
Yan LI ; Yong ZENG ; Zhuangfei CHEN ; Xiujie ZHANG ; Xinyi DUAN ; Yuanyuan LI
Journal of Kunming Medical University 1990;0(02):-
Objective To analyze sleep quality in patients with primary angle-closure glaucoma and its relationship with eyesight, which would provide the basic data for improvement of clinical therapy of primary angle-closure glaucoma.Methods Sleep quality of 49 patients with primary angle-closure glaucoma was evaluated by Pittsburgh Sleep Quality Index(PSQ I) and the relationship between sleep quality and eyesight was analyzed.Results 93.9% primary angle-closure glaucoma patients had sleep disorder.Differences were detected between the scores of PSQI and those in Chinese Norm(P
3.Research progress of long non-coding RNA in medical parasitology
Yannan GAO ; Su HAN ; Xinyi HU ; Shanshan DUAN ; Beibei SUN ; Weizhe ZHANG ; Xiaoli ZHANG
Chinese Journal of Endemiology 2021;40(2):160-163
Long non-coding RNA (lncRNA) is defined as non-protein coding transcript longer than 200 nucleotides. In the form of RNA, it affects gene expression at the epigenetic, transcriptional and post-transcriptional levels, and is widely involved in the body's pathophysiological processes. This review summarizes the research progress of lncRNA in the field of parasitology in order to find new targets for the prevention and treatment of parasitic diseases.
4.Effect of percutaneous coronary intervention and medical therapy on quality of life and cognitive function in patients with coronary heart disease
Fen CAO ; Baojian ZHANG ; Xinyi LI ; Shu DUAN
Journal of Central South University(Medical Sciences) 2018;43(5):544-551
Objective:To explore the effect and difference of percutaneous coronary intervention (PCI) and medical therapy on quality of life and cognitive function in patients with coronary heart disease (CHD),and to investigate the relationship between quality of life and cognitive function.Methods:A total of 320 patients with CHD,who underwent coronary angiography and PCI (PCI group,n=160),or underwent coronary angiography and medical therapy (drug therapy group,n=160),were selected.The quality of life was assessed by using the Health Survey Form SF-36 (SF-36) and the Seattle Angina Questionnaire (SAQ),and the cognitive function was assessed by using the Mini-Mental State Examination (MMSE).General data of patients were collected on the day of coronary angiography.Telephone follow-up was conducted in 1 month after treatment,and the outpatient review was carried out in 3 and 6 months after treatment.Results:A total of 309 valid questionnaires were collected.The scores of quality of life in the PCI group and the drug therapy group after treatment were both increased compared with those before treatment (both P<0.05).The SF-36 scores of four dimensions (role physical,bodily pain,vitality and mental health) in the PCI group were all significantly greater than those in the drug therapy group (all P<0.05).The SAQscores of two dimensions (angina stability and angina frequency) were both higher in the PCI group than those in the drug therapy group in 6 months of post-operation (all P<0.05).There was no significant difference in cognitive function before and after the treatment in the 2 groups (P>0.05).There was no significant difference in cognitive function between the PCI group and the drug therapy group (P>0.05).In the PCI group,physical function,role physical,bodily pain,and role emotional were positively correlated with cognitive function (r=0.207,0.182,0.184,0.176 respectively,all P<0.05).In the drug therapy group,there was no correlation between quality of life and cognitive function.Conclusion:The quality of life for the patients is improved in the PCI group and the drug therapy group,but the improvement degree in the PCI group is more obvious.Both PCI and drug therapy do not result in the decrease of cognitive function,and there is no difference between the 2 groups.There is positive correlation between quality of life and cognitive function in the PCI group,there is no correlation between quality of life and cognitive function in the drug therapy group.
5.miR-143 suppresses the proliferation and migration of SGC7901 gastric cancer cells
Xinyi WANG ; Haiyang ZHANG ; Shuang LI ; Tao NING ; Le ZHANG ; Jingjing DUAN ; Yanjun QU ; Yiran SI ; Yi WANG ; Guoguang YING ; Yi BA
Chinese Journal of Clinical Oncology 2016;43(16):702-706
Objective:To investigate the role and mechanism of miR-143 in the proliferation and migration of gastric cancer (GC) cells. Methods:Western blot was performed to detect the expression level of avian erythroblastosis oncogene B-3 (ERBB3) in GC tissues, paired non-cancerous tissues, and SGC7901 GC cells. RT-qPCR was conducted to determine the mRNA and miR-143 of ERBB3 quantita-tively. Bioinformatics tools were used to predict the target gene of miR-143. Luciferase reporter assay was carried out to confirm the predicted target gene. Transwell and EdU assays were applied to observe the migration and proliferation of SGC7901 GC cells transfect-ed with miR-143 mimics/inhibitor/NC mimics/inhibitor. Results:Compared with the expression levels of ERBB3 and miR-143 in the paired non-cancerous tissues, the expression level of ERBB3 was upregulated and the expression level of miR-143 was downregulated in GC tissues. In the prediction of the potential target gene, miR-143 could bind to a specific sequence of the 3′-untranslated regions (UTR) of the mRNA of ERBB3. This finding was supported by luciferase reporter assay results. In vitro, ERBB3 protein expression and cell migration and proliferation were suppressed significantly in the SGC7901 cells transfected with miR-143 mimics. By contrast, these processes were remarkably enhanced when the cells were transfected with miR-143 inhibitor. Conclusion:miR-143 can suppress the migration and proliferation of GC cells by downregulating the expression of ERBB3.
6.New finding of the expression of human beta defensin-4 in healthy gingiva.
Xinyi LI ; Dingyu DUAN ; Panpan WANG ; Bo HAN ; Yi XU
West China Journal of Stomatology 2013;31(2):165-168
OBJECTIVETo investigate the expression and the distribution of human beta defensin (hBD)-4 in healthy gingiva.
METHODSHealthy gingival specimens were collected. The expression of hBD-4 peptides in 18 gingival specimens were detected by immunohistochemistry. The hBD-4 mRNA were determined in freshly isolated gingival tissue by real time reverse transcription-polymerase chain reaction (real time RT-PCR) in 30 gingival specimens.
RESULTSIn 18 gingival specimens, hBD-4 peptides were expressed in 13 gingival specimens. In 30 gingival specimens, hBD-4 were detected in 4 gingival specimens by real time RT-PCR.
CONCLUSIONThe distribution and the expression levels of hBD-4 are different in healthy gingiva. This result may suggest that the hBD-4 play a role in maintaining the periodontal health.
Gingiva ; Humans ; RNA, Messenger ; beta-Defensins
7.Significance of Serum β-NGF and TRAIL Testing in Clinical Diagnosis and Prognosis Assessment in Patients with Pulmonary Heart Disease Complicated with Pulmonary Artery Hypertension
Wenhui TANG ; Huiling YING ; Jing DUAN ; Zhuo DONG ; Xinyi YOU
Journal of Modern Laboratory Medicine 2024;39(4):131-137
Objective To explore the significance of serum β-nerve growth factor(β-NGF)and tumor necrosis factor-related apoptosis-inducing ligand(TRAIL)testing in clinical diagnosis and prognosis assessment in patients with pulmonary heart disease(PHD)complicated with pulmonary artery hypertension(PAH).Methods A 1:1 case-control study was conducted in Daxing District People's Hospital of Beijing from January 2019 to June 2022,in which 86 patients with PHD complicated with PAH and 86 patients with isolated PHD were selected as case group and control group.Retrospective analysis was conducted.The case group was divided into mild PAH group(n=39),moderate PAH group(n=25)and severe PAH group(n=22)according to pulmonary artery systolic pressure(PASP).Meanwhile,the case group was divided into good prognosis group(n=75)and poor prognosis group(n=11)based on the outcomes after one year of discharge.Demographic data and laboratory examination indicators of study subjects were collected,and serum β-NGF and TRAIL levels were measured using enzyme-linked immunosorbent assay(ELISA).Pearson product-moment correlation analysis was used to assess the relationship among β-NGF,TRAIL and PASP.Logistic regression analysis was performed to identify factors influencing PAH in patients with PHD.ROC curve was used to evaluate the diagnostic value of β-NGF and TRAIL for PAH.Cox proportional hazards regression analysis was carried out to assess the relationship among β-NGF,TRAIL and poor prognosis in patients with PHD complicated with PAH,and ROC curve was used to evaluate its predictive value for poor prognosis.Result Compared with control group,the duration of PHD in case group was longer(8.63±1.27 years vs 5.49±1.15 years),and serum β-NGF level(26.97±8.25 ng/ml vs 22.14±7.32 ng/ml)and TRAIL level(2.83±0.76 ng/ml vs 1.71±0.68 ng/ml)were increased,with significant differences(t=17.006,4.064,10.183,all P<0.05).Serum β-NGF and TRAIL had certain diagnostic values for PAH in PHD patients,with AUC of 0.842 and 0.838,respectively.And the combined diagnostic AUC was 0.920,which was higher than that of single indicators(Z=3.416,3.508,all P<0.05).Serum β-NGF(23.26±5.13 ng/ml,27.83±5.57 ng/ml,32.57±6.02 ng/ml)and TRAIL(2.24±0.65 ng/ml,2.89±0.71 ng/ml,3.81±0.90 ng/ml)levels among patients with mild PAH,moderate PAH,severe PAH were sequentially elevated,and the differences were significant(F=20.624,31.972,all P<0.05).Serum β-NGF and TRAIL were positively associated with PASP(r=0.673,0.659,P<0.05).Serum β-NGF(36.34±8.05 ng/ml)and TRAIL(3.49±1.01 ng/ml)levels in poor prognosis group were higher compared to good prognosis group(25.59±7.28 ng/ml,2.73±0.89 ng/ml),and the differences were significant(t=4.516,2.604,all P<0.05).Logistic regression analysis showed that,the PHD duration[OR(95%CI):1.784(1.135~2.806)],β-NGF[OR(95%CI):1.976(1.108~3.523)]and TRAIL[OR(95%CI):1.866(1.123~3.101)]were independent risk factors for occurrence of PAH in patients with PHD(all P<0.05).Multivariate COX proportional risk regression results showed that PHD duration[OR(95%CI):1.167(1.082~1.364)],β-NGF[OR(95%CI):1.322(1.134~1.649)],TRA-IL[OR(95%CI):1.259(1.087~1.590)]were independent risk factors for poor prognosis in patients with PHD complicated with PAH(all P<0.05).Serum β-NGF and TRAIL could predict the poor prognosis in patients with PHD complicated with PAH,with AUC of 0.863 and 0.881,respectively.The combined diagnostic AUC was 0.907,which was higher than that of single indicators(Z=2.905,3.128,all P<0.05).Conclusion Elevated serum β-NGF and TRAIL were independent risk factors for PAH and were associated with severity of PAH.Early combined detection of β-NGF and TRAIL can improve the diagnostic value for PAH and predict poor prognosis of patients.
8.Phenotypic spectrum of cerebral autosomal-dominant arteriopathy with subcortical infarcts and leukoencephalopathy in Fujian, China: a study based on screening scale
Naiqing CAI ; Qingxiang ZHANG ; Yunqiu ZHENG ; Yanqin ZENG ; Xinyi DUAN ; Ning WANG ; Zhiwen LI ; Bin CAI
Chinese Journal of Neurology 2019;52(1):8-13
Objective To summarize the phenotypic spectrum of cerebral autosomal-dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL) in Fujian population,evaluate the efficiency of the scale and try to adjust it.Methods Thirty-eight CADASIL patients and 64 CADASIL-like patients were recruited based on the CADASIL scale and gene tests,who visited the First Affiliated Hospital of Fujian Medical University and Fujian Neurology Research Institute from May 2011 to November 2017.Their clinical and neuroimaging characteristics were analyzed.Results The migraine,migraine with aura,transient ischemic attack / stroke,early onset age,psychiatric disturbances,cognitive decline,leukoencephalopathy,subcortical infarcts showed no statistically significant differences between the two groups.Instead,compared with CADASIL-like patients (10/64,15.6%;47/64,73.4%;10/64,15.6%),CADASIL patients demonstrated higher percentages of temporal pole involvements (13/38,34.2%;x5=4.716,P=0.030),external capsule involvements (36/38,94.7%;P=0.008) and family history in at least two generations (13/38,34.2%;x2=4.716,P=0.030).According to the scale,the scores showed statistically significant difference between CADASIL (14.84 ± 3.03) and CADASIL-like patients (13.34 ± 3.31;t=2.282,P=0.025) with an area under receiver operating characteristic curve of 0.622.Conclusions CADASIL showed no specific symptoms in Fujian population.The neuroimaging features were proposed to be focused on,especially the external capsule involvements.CADASIL scale could improve diagnostic efficiency,but still needs to be adjusted for Fujian population.The weight value of migraine,migraine with aura and cognitive decline was suggested to be decreased.
9.The analysis of risk factors for cerebral microbleeds in cerebral infarction patients.
Naiqing CAI ; Liju XIE ; Zhiwen LI ; Qingxiang ZHANG ; Sheng ZHANG ; Dan'ni WANG ; Xiaoyan LIU ; Xinyi DUAN ; Hong LIN ; Bin. CAI
Chinese Journal of Nervous and Mental Diseases 2019;45(6):326-330
Objective To analyze the risk factors of cerebral microbleeds (CMBs) in acute cerebral infarction patients. Methods We consecutively included 255 acute cerebral infarction patients who were admitted in Neurology Department of the First Affiliated Hospital of Fujian Medical University from January 2014 to December 2016. According to the number and location of CMBs, the patients were divided into infratentorial, cortical and deep cerebral groups, each of which included non-mild and moderate-severe subgroups. The differences of the level of glomerular filtration rate (eGFR) and some common arteriosclerotic risk factors were analyzed between subgroups, and the multiple logistic regression analysis was performed. Results A total of 140 subjects (54.9%) had CMBs. In the infratentorial group, the proportion of patients who were with low eGFR level in the moderate-severe CMBs subgroup was higher than in the non-mild CMBs subgroup (P=0.024). The low eGFR level (OR=3.874, 95% CI:1.261~11.901, P=0.018) and the long duration of hypertension (OR=2.128, 95%CI: 1.004~4.510, P=0.018) were the independent risk factors of the moderate-severe infratentorial CMBs. Conclusion The low eGFR level and long duration of hypertension are risk factors for the moderate and severe infratentorial CMBs after acute ischemic stroke.
10.Isolation and structural identification of a potassium ion channel Kv4.1 inhibitor SsTx-P2 from centipede venom
Canwei DU ; Fuchu YUAN ; Xinyi DUAN ; Mingqiang RONG ; Er MENG ; Changjun LIU
Journal of Zhejiang University. Medical sciences 2024;53(2):194-200
Objective:To isolate a potassium ion channel Kv4.1 inhibitor from centipede venom,and to determine its sequence and structure.Methods:Ion-exchange chromatography and reversed-phase high-performance liquid chromatography were performed to separate and purify peptide components of centipede venom,and their inhibiting effect on Kv4.1 channel was determined by whole-cell patch clamp recording.The molecular weight of isolated peptide Kv4.1 channel inhibitor was identified with matrix assisted laser desorption ionization-time-of-flight mass spectrometry;its primary sequence was determined by Edman degradation sequencing and two-dimensional mass spectrometry;its structure was established based on iterative thread assembly refinement online analysis.Results:A peptide SsTx-P2 was separated from centipede venom with the molecular weight of 6122.8,and its primary sequence consists of 53 amino acid residues NH2-ELTWDFVRTCCKLFPDKSECTKACATEFTGGDESRLKDVWPRKLRSG DSRLKD-OH.Peptide SsTx-P2 potently inhibited the current of Kv4.1 channel transiently transfected in HEK293 cell,with 1.0 μmol/L SsTx-P2 suppressing 95%current of Kv4.1 channel.Its structure showed that SsTx-P2 shared a conserved helical structure.Conclusion:The study has isolated a novel peptide SsTx-P2 from centipede venom,which can potently inhibit the potassium ion channel Kv4.1 and displays structural conservation.