1.Derivative Synthesis of Wanpeinine A, a Major Steroidal Alkaloid from Fritillaria shuchengensis
Juan WEN ; Xianli ZHOU ; Renlong YAN ; Shuai HUANG ; Yinhui WANG
Chinese Herbal Medicines 2010;02(2):141-144
Objective To design and synthesize derivatives of wanpeinine A, the main steroidal alkaloid isolated from the plant Fritillaria shuchengensis, and further study on the structure-activity relationship of the steroidal alkaloid. Methods Acylation and alkylation were used to synthesize the derivatives and their structures were identified via NMR and MS.Results The acylation of wanpeinine A (1) produced 3β,6α-diacetylwanpeinine A (2), 3β,6α-dipropionylwanpeinine A (3), 3β,6α-dichloracetylwanpeinine A (4), 3β,6α-dibenzoylwanpeinine A (5), and 3β-methoxyacylwanpeinine A (6). The alkylation of wanpeinine A formed 3β,6α-dimethoxymethylwanpeinine A (7). Conclusion All compounds are new except for 3β,6α-diacetylwanpeinine A.
2.Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice.
Jiaming LAN ; Shuai LU ; Yao DENG ; Bo WEN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Virology 2016;32(1):77-81
Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.
Animals
;
Antibodies, Viral
;
immunology
;
Computational Biology
;
Coronavirus Infections
;
immunology
;
prevention & control
;
virology
;
Female
;
Humans
;
Immunization
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
immunology
;
Peptides
;
administration & dosage
;
genetics
;
immunology
;
Spike Glycoprotein, Coronavirus
;
administration & dosage
;
genetics
;
immunology
;
Viral Vaccines
;
administration & dosage
;
genetics
;
immunology
3.Development of peptidic MERS-CoV entry inhibitors.
Shuai XIA ; Qian WANG ; Shu-wen LIU ; Lu LU ; Shi-bo JIANG
Acta Pharmaceutica Sinica 2015;50(12):1513-1519
In 2012, a new SARS-like coronavirus emerged in the Middle East, namely the Middle East respiratory syndrome coronavirus (MERS-CoV). It has caused outbreaks with high mortality. During infection of target cell, MERS-CoV S protein S1 subunit binds to the cellular receptor (DPP4), and its S2 subunit HR1 and HR2 regions intact with each other to form a stable six-helix bundle to mediate the fusion between virus and target cell membranes. Hence, blocking the process of six-helix bundle formation can effectively inhibit MERS-CoV entry into the target cells. This review focuses on the recent advance in the development of peptidic entry inhibitors targeting the MERS-CoV S2 subunit.
Antiviral Agents
;
pharmacology
;
Coronavirus Infections
;
drug therapy
;
Dipeptidyl Peptidase 4
;
metabolism
;
Drug Design
;
Humans
;
Middle East Respiratory Syndrome Coronavirus
;
drug effects
;
physiology
;
Peptides
;
pharmacology
;
Spike Glycoprotein, Coronavirus
;
metabolism
;
Virus Internalization
;
drug effects
4.Structural changes of substantia nigra in patients with unilateral Parkinson′s disease
Xinxin MA ; Wen SU ; Shuhua LI ; Haibo CHEN ; Shuai PENG ; Chunmei LI ; Rui WANG ; Min CHEN
Chinese Journal of General Practitioners 2016;15(10):782-785
Magnetic resonance imaging ( MRI ) findings were studied in 19 patients with non-dementia Parkinson′s disease ( PD) Hoehn-Yahr Stage 1 and 1.5 and 38 healthy subjects.The width and area of pars compacta of substantia nigra ( SNc) , substantia nigra ( SN) and midbrain were measured.The width and area ratios of SNc to SN were calculated.Compared with controls, the widths of right SNc was narrower, bilateral ratios of SNc to SN width were decreased in PD group.As to the area of substantia nigra, there was no significant difference between PD and controls.The width of left SN and the ratio of right SNc to SN width was negatively correlation with age of patients.The ratio of left SNc to SN width, the area of bilateral SNc and left SN, as well as the ratio of right SNc to SN area had negative correlation with the disease duration;however, there was no correlation with gender, Hoehn-Yahr Stage, the Unified Parkinson disease rating scale score, mini mental state scale, education years, levodopa equivalent daily dose, Hamilton Depression Scale or Hamilton Anxiety Scale in PD group.The results indicate that there are bilateral structural changes of SN in unilateral PD patients, which may be more significant with increasing disease duration.The measurement of SNc width and SN area can be used as an objective indicator for diagnosis and disease progression monitoring of PD.
5.Preoperative management of cardiac surgery with glucose-6-phosphate dehydrogenase deficiency
Hai-yong, WANG ; Yi-yao, JIANG ; Wen-bin, ZHANG ; Jian-fei, SONG ; Shuai-zhou, LIU
Chinese Journal of Endemiology 2011;30(6):691-693
Objective To observe the perioperative management of cardiac surgery and extracorporeal circulation method in patients with glucose-6-phosphate dehydrogenase deficiency(G6PD).Methods Ten patients with G6PD deficiency underwent uneventful cardiac surgery procedures between January 2005 and December 2010.Twenty patients who had non-G6PD deficiency were as a control group,the selected conditions were the same gender,age,body mass,the risk of heart disease surgery.The preoperative management in patients with G6PD deficiency mainly focused on avoiding the drugs implicated in haemolysis,reducing the surgical stress,using moderate hypothermia extracorporeal circulation and enhancing blood conservation.Observed indicators included the assisted ventilation time,urine volume,the drainage volume of chest tube,the amount transfusion of red blood cells and plasma,the level of hemoglobin and serum total bilirubin in the 2nd day after surgery,ICU stay.Results Compared with the control group,patients with G6PD deficiency had no significant difference in duration of ventilation after the operation,drainage,urine,Hgb,bilirubin levels,and blood transfusion[(9.3 ± 4.5)h vs (8.6 ± 5.7)h,(2100 ±670)ml vs (1950 ± 490) ml,(253 ± 146)ml vs (260 ± 120)ml,(1.3 ± 1.0)U vs (1.8 ± 1.2)U,(96 ± 25)g/L vs (99 ± 12)g/L,and (24 ± 8)μmol/L vs (27 ± 1 l)μmol/L,t =0.978,2.032,1.257,0.891,2.182,2.271,and 1.329,all P > 0.05].The duration of ICU discharge was significantly longer in the glucose-6-phosphate dehydrogenase deficient group[ (2.6 ± 0.6)d vs (1.8 ± 1.5)d,t =2.704,P < 0.05].Conclusions Cardiac surgery can be performed safely in patients with G6PD deficiency with enhanced perioperative management.
6.Production and Identification of Broad Spectrum Monoclonal Antibody against a Group of Pyrethroid Insecticides
Mengtang WEN ; Yuan LIU ; Shuai YAN ; Xiao ZHANG ; Heng WANG ; Xianjin LIU
Chinese Journal of Analytical Chemistry 2014;(9):1245-1251
The objective of this study is to generate broad spectrum monoclonal antibody ( mAb ) against a group of pyrethroid insecticides and to identify its immunological characteristics. The generic hapten 3-phenoxy-benzoic acid ( PBA) was conjugated to carrier protein BSA by activated ester method. Balb/c mice were immunized with PBA-BSA. The titer of polyclonal antibody ( pAb ) was detected by indirect enzyme-linked immunosorbent assay ( ELISA) after five times immunization. The mouse with high titer and sensitivity was selected for cell fusing. The splenocytes of immunized mice were fused with Sp2/0 cells and the cultural supernatants of hybridoma cells were screened by indirect non-competitive ELISA based on the coating antigen PBA-ovoalbumin ( PBA-OVA ) . High-sensitivity and high-specificity mAb was prepared after subcloning using limiting dilution method. Purified mAb was obtained after purified by saturated ammonia sulfate precipitation and protein G affinity column. The immunological characteristics of mAb such as titer, antibody subtypes, affinity constant and the sensitivity to pyrethroid insecticides were characterized by indirect ELISA; The results of UV spectroscopy and SDS-PAGE showed that PBA-BSA artificial antigen was synthesized successfully. A hybridoma cell line (4H11) secreting anti-pyrethroid mAb was established. The titre of ascites was up to 1:6. 5×106, and the mAb was IgG1 subtype. The affinity constant of the mAb to PBA was about 2. 5×107 L/mol, with a IC50 value of 208. 83 μg/L and a detection limit of 21. 23 μg/L to PBA. Simultaneously, beta-cypermethrin, flucythrinate, cypermethrin and fenvalerate were sensitively recognized by the mAb with the IC50 of 1. 01, 2. 15, 3. 16 and 3. 67μg/L, respectively.
7.Correlation between IQQA(R)-Liver system in planning liver resection with the actual operation
Zhanliang SU ; Qian JI ; Hao WANG ; Shuai HAN ; Jing YU ; Wen SHEN
Chinese Journal of Hepatobiliary Surgery 2014;20(4):294-298
Objective To correlate between the IQQA(R)-Liver system in planning liver resection and the actual operation performed by surgeons.Methods The data on 65 patients were retrospectively studied.Their preoperative enhanced CT images were analyzed by the IQQA(R)-Liver system to determine the operative plan (Group Q) including the operative technique,the major vessels which required to be transected and the virtual liver resection volume.The above results and the corresponding data collected from the actual operation (Group S) were statistically analyzed to find out whether there was any correlation between them,thus determining the clinical significance of the IQQA(R)-Liver system in preoperative evaluation.Results Group Q and Group S had good correlation in the operative techniques (O) and in the major vessels that required to be transected (A) (uO =0.835,uA =0.893) with no statistical difference between the 2 groups (PO =0.494,PA =0.331).The virtual liver resection volume was 633.96 ± 512.06 (78.30 ~2 559.38)cm3.Conclusion Preoperative evaluation by the IQQA(R)-Liver system had significance in planning partial hepatectomy.
8.Medical and health organization management information system at grass-root level and platform at county level for data exchange in Sichuan Province:their design and implementation
Shuai WANG ; Xiaodong LIN ; Minghui SHEN ; Yunpeng MAO ; Ren DENG ; Wen CHEN ; Hu LONG
Chinese Journal of Medical Library and Information Science 2015;(9):12-16
The medical and health organization management information system at grass-root level and platform at county level for data exchange in Sichuan Province were designed and constructed according to the health information exchange service network in Sichuan Province and standard medical CDA file, in order to implement data exchange on the medical and health organization management information system at grass-root level and platform at county level, to insure the basic medical and health service for the public, and to improve their health level.
9.Hospital big data-based diagnosis and treatment decision-making support model for grass-root medical institutions
Shuai WANG ; Minghui SHEN ; Changqi FENG ; Wen CHEN ; Huaping GAN ; Hu LONG
Chinese Journal of Medical Library and Information Science 2015;(4):66-69
A hospital big data-based innovative diagnosis and treatment decision-making support model ( Info Button) was proposed for grass-root medical institutions in Sichuan Province in view of uneven distribution of its medical resources and of beingdifficult and expensive to see a doctoraccording to an analysis of the major health information projects and health information management.How to construct the model was elaborated with its problems pointed out.
10.R language-based analysis of big data about drugs prescribed in grass root clinics
Shuai WANG ; Xiaodong LIN ; Minghui SHEN ; Ren DENG ; Yunpeng MAO ; Changqi FENG ; Wen CHEN ; Hu LONG
Chinese Journal of Medical Library and Information Science 2015;(3):54-58
Objective To provide the evidence for health management decision-making and rational use of drugs grass root clinics by studying their drug prescription rules.Methods The prescribed drugs in clinics of 5 township health centers from September 2012 to September 2014 were retrieved from The Management Information System of Sichuan Grass Root Medical Institutions.Their big data were analyzed using R language.Results The commonly pre-scribed drugs in clinics were vitamin B6, vitamin C and cefixime tablets, which were usually used in combination. Conclusion Health administrative organizations can strengthen their supervision and management of prescribed drugs and promote their rational use in grass root clinics using unified management information system of grass root medical institutions in combination with information technology .