1.PD-1/PD-L1 signaling pathway and its application in tumor
Shi WANG ; Longlong LUO ; Ming LV ; Yuanfang MA
Journal of International Pharmaceutical Research 2015;(2):143-147
PD-1/PD-L1 signaling pathway as a T cell immune response co-stimulatory signaling pathway plays an important role in adaptive immunity. PD-1 is a major co-receptor expressing on T cells, binding with its ligands(PD-L1 and PD-L2), PD-1 can inhibit T cell activation and protect the body against the attacks from its own immune system. In addition to adjusting and maintaining autoimmune tolerance, in tumor cells PD-L1 expression is up-regulated, while in the virus-infected T cells PD-L1 expression is also upregulated. PD-1 / PD-L1 are involved in the tumor and infectious pathogen immune evasion, thus blocking the PD-1 / PD-L1 signaling pathway has become a hot research of cancer and chronic diseases. Currently, there are several anti-PD-1 or PD-L1 monoclonal antibodies approved by the FDA to enter clinical studies, which have shown significant anti-cancer effect.
2.Significance and analysis of unconcentrated urine sample from patients with pregnancy induced hypertension syndrome by protein electrophoresis
Xiao-Huan ZHAO ; Shi-Ming LV ; Yan ZHANG ; Fei ZHENG ;
Chinese Journal of Laboratory Medicine 2003;0(10):-
Objective To investigate the relationship between proteinuria components and the severity of pregnancy induced hypertension syndrome (PIH), the unconcentrated urine samples from patients with PIH were analyzed on proteinuria components by electrophoresis.Methods Proteinuria components were analyzed by sodium dodecyl sulfate-agarose gel electrophoresis (SDS-AGE) in unconcentrated urine samples from PIH patients (PIH group,n=114) and normal third trimester pregnant women (control group,n=110).Results Eleven kinds of urinary protein were detected in the PIH group and four in the control group. The results showed positive relationship between the urine protein component complexity and the severity of PIH (P
3.Observation of binocular vision after surgical corrections in V - pattern exotropia children
Xiao-Hua, XIE ; Lu, LV ; Hong-Bin, DAI ; Xiang-Yun, LI ; Ming-Hua, SHI
International Eye Science 2015;(7):1301-1302
AlM:To observe the changes of binocular vision in V-pattern exotropia children before and after surgical correction, and the effect of training in reconstructing the binocular vision after surgical corrections.METHODS: Sixty V-pattern exotropia children were enrolled in this study and were divided into three groups according to their age:group A (4~6 years old), group B (7~9 years old), and group C (10~12 years old), 20 cases for each group. Patients received routine refraction and ophthalmic examinations. Distance and near deviation were measured by prism-covering method and synoptophore. The simultaneous perception and fusion were examined with a synoptophore, and the stereacuity was measured with stereograms ( Titmus) . The children who didn’t reconstruct binocular vision function 1wk after surgery received binocular vision training. The data were recorded before and 1 , 2, 4, and 8wk after surgery. RESULTS: Binocular vision significantly improved among the children after surgery in group A and B ( P<0. 05 ) . Significantly divergence showed between group C and the other groups 1wk after surgery ( P < 0. 05 ). Binocular vision of the three groups all significantly improved 8wk after surgery, with no significant differences (P>0. 05). CONCLUSlON: V - pattern exotropia children can benefit from early surgical correction and training after surgery in reconstruct binocular vision.
4.125Ⅰ seed brachytherapy for recurrent salivary gland carcinoma after external radiotherapy.
Huan Bin YU ; Wen Jie WU ; Xiao Ming LV ; Yan SHI ; Lei ZHENG ; Jian Guo ZHANG
Journal of Peking University(Health Sciences) 2020;52(5):919-923
OBJECTIVE:
To investigate the clinical application and efficacy of 125Ⅰ radioactive seeds implantation in the treatment of recurrent salivary gland carcinoma after external radiotherapy.
METHODS:
From July 2004 to July 2016, 43 cases of recurrent salivary gland carcinoma of the neck after external radiotherapy or surgery combined with external radiotherapy were treated. According to the conventional segmentation radiotherapy for head and neck cancer (once a day, 1.8-2.0 Gy each time, 5 days per week), the cumulative radiation dose of the patients in this group was calculated. In the study, 26 patients received 50-60 Gy, 7 patients received less than 50 Gy, 4 patients received 60-70 Gy, and 6 patients received more than 80 Gy (range: 80-120 Gy). The interval between the last external irradiation and local recurrence was 4-204 months, and the median interval was 48 months. Among them, 25 cases were treated with 125Ⅰ radioactive seeds implantation only and 18 cases were treated with 125Ⅰ radioactive seeds implantation after operation. The prescription dose was 100-140 Gy. The control rate, survival rate and disease-free survival rate were recorded to evaluate the side effects.
RESULTS:
The median follow-up time was 27 months (ranging from 2.5 to 149.0 months). Among them, the median follow-up time of adenoid cystic carcinoma patients was 31 months (range: 2.5-112.0 months), and the median follow-up time of mucoepidermoid carcinoma patients was 18 months (range: 5-149 months). The local control rates for 1, 3 and 5 years were 66.5%, 48.8% and 42.7%, respectively. The 1-, 3- and 5- year survival rates were 88.0%, 56.7% and 45.8%, respectively. The disease-free survival rates of 1, 3 and 5 years were 58.3%, 45.4% and 38.1%, respectively. There was no statistically significant difference in local control rate, survival rate, and disease-free survival between the radioactive seeds implantation group and the radioactive seeds implantation group after surgical resection. There were 2 cases of acute radiation reaction Ⅰ/Ⅱ and 3 cases of reaction Ⅲ or above. In the late stage of radiotherapy, there were 8 cases with Ⅰ/Ⅱ grade reaction and 3 cases with Ⅲ grade or above reaction. The incidence of radiation reactions of Grade Ⅲ and above was 7%.
CONCLUSION
125Ⅰ radioactive seeds implantation provides an alternative method for the treatment of recurrent salivary gland carcinoma after external radiotherapy. The local control rate and survival rate are improved on the premise of low incidence of side effects.
Brachytherapy/adverse effects*
;
Humans
;
Iodine Radioisotopes/therapeutic use*
;
Neoplasm Recurrence, Local/radiotherapy*
;
Salivary Gland Neoplasms/radiotherapy*
;
Salivary Glands
5.Role of arginine in wound healing of diabetic rats
Wei-Ming LV ; Shang-Tong LEI ; Qiang ZHANG ; Yun-Jian ZHANG ; Shen-Ming WANG ; Han-Ping SHI ;
Chinese Journal of Trauma 2003;0(09):-
Objective To observe effect of arginine on wound healing of diabetic rats.Meth- ods Forty male Lewis rats were equally and randomly divided into diabetic group and normal control group.The diabetic group were rendered with diabetic by using intraperitoneal(IP)streptozotocin seven days prior to surgery and underwent a dorsal skin incision with implantation of polyvinyl-alcohol sponges. Either of two groups were subdivided into arginine treatment group and saline treatment group,10 rats in each group,of which the arginine treatment group received arginine at 1 g/kg per day by IP injection, while the saline treatment group received saline injection only.Animals were sacrificed 10 days post wound to observe antibreakage tension,hydroxyproline content and mRNA expression of procollagenⅠandⅢ.Results Diabetic wounds had greatly decreased breaking strengths compared with controls. Arginine significantly enhanced wound breaking strengths,increased wound hydroxyproline levels and ele- vated mRNA for procollagenⅠandⅢin both diabetic and control animals as compared to their saline-trea- ted counterparts.Conclusion Arginine can effectively promote healing of diabetic wounds in rats.
6.The China Kadoorie Biobank: related methodology and baseline characteristics of the participants
Li-Ming LI ; Jun LV ; Yu GUO ; Collins RORY ; Jun-Shi CHEN ; Peto RICHARD ; Fan WU ; Zheng-Ming CHEN
Chinese Journal of Epidemiology 2012;33(3):249-255
Objective To study the separate and combined effects of environment,lifestyle,physical characteristics,blood biomarkers and genetic factors on aetiology of major chronic diseases in adult Chinese.Methods China Kadoorie Biobank (CKB) is a large blood-based prospective cohort study.The baseline survey took place in 5 urban and 5 rural areas across China during 2004-2008,with collection of data through questionnaire,physical examination and blood samples.Following the baseline survey,5% of the randomly selected participants were surveyed in 2008,and repeated every 4-5 years.All participants would be followed for cause-specific mortality and morbidity through registries and for any hospital admission through linkages with health insurance databases.Results Overall,512 891 adults aged 30-79 years (mean 51.5) were recruited,including 41.0% men and 55.9% from rural areas.Blood collection was successfully done in 99.98% of the participants.The prevalence of current regular smoking was 61.3% in men and 2.4% in women.The prevalence of regular alcohol consumption (i.e.,weekly) was 33.4% in men and 2.1% in women.At the baseline,41.8% of men and 45.3% of women were overweight or obese (i.e.,BMI≥24.0 kg/m2) and 32.2% of men and 30.2% of women were hypertensive (i.e.,SBP≥140 mm Hg or DBP≥90 mm Hg).For each of the main baseline variables,there were large variations on age,sex and areas of study.Conclusion CKB seemed to be a powerful and rich resource in studying the environmental and genetic determinants of major chronic diseases in the Chinese population.
7.Effects of bm47 deletion on viral replication and transcription of Bombyx mori nucleopolyhedrovirus.
Chen ZHANG ; Zhen-Nan ZHU ; Jia YUAN ; Yang-Hui SHI ; Jian CHEN ; Zuo-Ming NIE ; Zheng-Bing LV ; Yao-Zhou ZHANG ; Wei YU
Chinese Journal of Virology 2014;30(3):285-291
Bombyx mori nucleopolyhedrovirus (BmNPV) bm47 gene is found in all sequenced lepidopteran nucleopolyhedroviruses (NPVs). It is one of the core genes of NPVs. However, the role of bm47 in the biological cycle of NPV remains unknown. In this study, the Red recombination system was used to knock out bm47 from BmNPV to construct bm47-ko-Bacmid in E. coli BW25113 system. Then bm47 gene was introduced back to the viral genome using the Bac-to-Bac system to create the repair virus bm47-re-Bacmid. TCID50 assay and real-time PCR (qPCR) were used to evaluate the effects of bm47 deletion on viral DNA replication, gene transcription, and protein expression. qPCR results showed that bm47 knock-out had no significant effect on viral DNA replication. However, the qPCR results showed that bm47-ko-Bacmid significantly decreased the transcription levels of early gene lef-3, late gene vp39, and very late gene p10 at 48 h and 72 h after viral transfection of BmN cells (P < 0.05). This work will provide a foundation for further studies on the biological function of BmNPV bm47 in viral replication and transcription.
Animals
;
Bombyx
;
virology
;
Gene Deletion
;
Gene Expression Regulation, Viral
;
Nucleopolyhedrovirus
;
genetics
;
physiology
;
Transcription, Genetic
;
Viral Proteins
;
genetics
;
metabolism
;
Virus Replication
8.Enrichment of saponins in Radix et Rhizoma Cynanchi Atrati with macroporous resin.
Yong-hai LV ; Yun YANG ; Shi-kai YAN ; Ming-jin LIANG ; Hao HUANG ; Wei-dong ZHANG
China Journal of Chinese Materia Medica 2008;33(12):1390-1393
OBJECTIVETo develop an approach to the determination of saponins in Radix Cynanchi Atrati, and to optimize the parameters for purified the preparation of total saponins by macroporous resin column chromatography.
METHODUsing cynanversicoside A as a reference, the determination of saponins was performed; according to the elution rate and the purity of the products, the preparation performance of total saponins by macroporous resin was investigated, and its parameters were optimized.
RESULTThe saponins in Radix Cynanchi Atrati were successfully determined at 518 nm by vanillin-perchloric acid as spray reagent. The macroporous resin HP-20 showed static absorption ratio of 59. 3 mg x g(-1); the 70% ethanol extraction of Radix Cynanchi Atrati was eluted from column of macroporous resin HP-20 by water and 30% ethanol, and the saponins were concentrated in 90% ethanol solution. The content of saponin part eluted from HP-20 column was 77.62%.
CONCLUSIONThe proposed approach allows convenient and efficient preparation and purification of saponin in Radix Cynanchi Atrati.
Absorption ; Benzaldehydes ; chemistry ; Calibration ; Cynanchum ; chemistry ; Ethanol ; chemistry ; Perchlorates ; chemistry ; Porosity ; Reproducibility of Results ; Resins, Plant ; chemistry ; Saponins ; chemistry ; isolation & purification ; Sensitivity and Specificity
9.Oogenesis in summer females of the rice water weevil, Lissorhoptrus oryzophilus Kuschel (Coleoptera: Curculionidae), in southern Zhejiang, China.
Sheng-wei SHI ; Ming-xing JIANG ; Han-wu SHANG ; Hui-ping LV ; Jia-an CHENG
Journal of Zhejiang University. Science. B 2007;8(1):33-38
The rice water weevil, Lissorhoptrus oryzophilus Kuschel, has two generations in southern Zhejiang, China. To determine oogenesis in first-generation females (summer females) and its relations to temperature, females were collected from a rice field in early and mid-July and reared on young rice plants at 28, 31 and 34 degrees C in the laboratory. Percentage of females having oocytes, number of oocytes of different stages (stage-I, from early previtellogenesis to middle vitellogenesis; stage-II, late vitellogenesis; and mature-oocyte stage), and length of ovarioles were determined every 10 d of feeding. At each temperature, oogenesis took place in over 40% of females after 20~40 d of feeding, but only 0.0~3.3 stage-I, 0.0~0.8 stage-II and 0.0~1.1 mature oocytes were observed at each observation date. Temperature had significant effect on number of stage-I oocytes but not on number of stage-II and mature oocytes in early July females; temperature had no significant effect on number of oocytes of either stage in mid-July females. Conclusively, in southern Zhejiang, summer L. oryzophilus females have great potential to become reproductive on rice, but their oogenesis activity is very low, with the overall procedures little affected by temperature.
Animals
;
China
;
Female
;
Oogenesis
;
Oryza
;
parasitology
;
Seasons
;
Temperature
;
Weevils
;
genetics
;
pathogenicity
10.A study on the association among serum insulin,IGFBP3, and endometrial cancer risk in Chinese women
Jia-Min HUANG ; Yan ZHANG ; Shi-Ming LV ; Qing-Qing WANG
Journal of Preventive Medicine 2016;28(4):358-361
Objective Toexploretheassociationamongseruminsulin,IGFBP3,andendometrialcancerriskinChinese women.Methods SeruminsulinandIGFBP3weredetectedbyELISAmethodin206patientswithendometrialcarcinoma and 310 healthy women.Using logistic regression analysis after adjustments for BMI,serum glucose and triglycerides to exploretheassociationamongthetwoindicatorsandtheriskofendometrialcarcinoma.Results Increasedinsulinwere found in the women with endometrial carcinomas as compared with that of controls [Mean ±SD:insulin (14.84 ±16.72) uU·mL-1 in women with cancer versus (8.13 ±9.40)uU·mL-1 in controls,P<0.01].However,serum IGFBP3 was not significantly higher in women with endometrial cancer [Mean ±SD:IGFBP3 (1.76 ±2.44)mg·L-1 in women with cancer versus (1.57 ±1.80)mg·L-1in controls,P>0.05].The risk for endometrial cancer was significantly higher in the upper quartile relevant to the lowest quartile of serum insulin,and lower in the upper quartile of serum IGFBP3 (P<0.05).Logistic regression analysis showed that serum insulin was the risk factor of endometrial carcinoma(OR=2.34, 95%CI:1.32 -4.14),after adjusting obesity/overweight status,serum glucose,total cholesterol,total glyceride,and HDL-C.Conclusion HyperinsulinemiawasanindependentriskfactorforendometrialcarcinomasinChinesewomen. However,the protective role of increased serum IGFBP3 should be validated further.