1.Executive function characteristic in boys with attention deficit hyperactivity disorder comorbid disruptive behavior disorders
Journal of Peking University(Health Sciences) 2004;0(03):-
Objective:To answer the question whether executive function(EF) deficits are specific to attention deficit hyperactivity disorder(ADHD) or whether such deficits are also associated with disruptive behavior disorders(DBD),including oppositional defiant disorder(ODD) and conductive disorder(CD).Methods:A total of 19 pure ADHD boys,19 ADHD + DBD boys and 19 normal controls(criteria of DSM-Ⅳ) were collected as our samples.The groups were matched by age(less than 6 months).The research instruments included Stroop color-word task,Rey complex figure test,digit span test, trail making test,tower of Hanoi and verbal fluency test.Results:The differences of IQs weren't significant among three groups.(1) Both pure ADHD group and ADHD+DBD group performed worse(P0.05).(2) Pure ADHD group also showed deficits in the aspects of errors of Stroop 2,time and errors of Stroop 3, word interference time;immediate memory structure score of Rey complex figure test;time and errors of number-letter part and shifting time of trail making test;total time and steps of completing tower of Hanoi.The differences were significant(P
2.Executive function characteristic in boys with attention deficit hyperactivity disorder comorbid learning disabilities
Journal of Peking University(Health Sciences) 2003;0(05):-
Objective:To study the executive function(EF)characteristics in boys with attention deficit hyperactivity disorder(ADHD)comorbid learning disabilities(LD).Methods:A total of 22 pure ADHD boys,22 ADHD + LD boys and 22 normal controls(by criteria of DSM-Ⅳ)were collected as our samples.The groups were matched by ages(less than 6 months)and ADHD subtypes.The research instruments included the Stroop color-word task,Rey complex figure test,digit span test,trail making test,tower of Hanoi and verbal fluency test.Results:The differences of VIQ weren't significant among the three groups;pure ADHD and ADHD+LD groups had lower PIQ than the control group;ADHD+LD boys had lower IQ than the controls.The performance in the EF tests:(1)Both pure ADHD and ADHD+LD groups performed worse in the aspects of time of number-letter part and shifting time,the repeat response of verbal fluency,and the differences were significant.But the differences between ADHD and ADHD+LD weren't significant.(2)ADHD+LD group also showed deficits in the aspects of time and errors of Stroops 2 and 4,time of Stroop 4,word interference time,the immediate memory and delayed recalling detail score of Rey complex figure test,time of number trail making,error steps(rule violation)of Tow of Hanoi,and the differences were significant.(3)Both ADHD+LD and pure ADHD groups made more errors in the naming color of the color-word card(Stroop part 4),and ADHD+LD boys performed worse than pure ADHD boys.Conclusion:The findings support the hypothesis that ADHD is related to EF deficit,whether or not comorbid LD.ADHD+LD showed significant difference in the aspects of inhibition,working memory,set shifting and fluency as compared with normal group,ADHD+LD boys perform more poorly than the pure ADHD boys.It's plausible that both ADHD and LD are associated with deficits of executive function.
3.Effect of methylphenidate on executive function for children with attention deficit hyperactivity disorder
Lan SHUAI ; Li YANG ; Qingjiu CAO ; Yufeng WANG
Journal of Peking University(Health Sciences) 2004;0(03):-
Objective:To explore whether methylphenidate(MPH) can improve the executive function(EF) of attention deficit hyperactivity disorder(ADHD) children and the degree of the improvements.Method:We conducted an open study of 29 children(25 boys and 4 girls) who met DSM-Ⅳ criteria for ADHD.The variations of their EF before and after methylphenidate extended-release tablets [osmotic release oral system(OROS) methylphenidate] treatment were evaluated,and the differences of EF between 24 ADHD boys before and after treatment and 24 age-matched typically developing control boys were compared.The research instruments included Stroop color-word task,Rey complex figure test,digit span test,trail making test,tower of Hanoi and verbal fluency test.Results:The performances of errors in Stroop 1,time and errors of Stroops 2 and 4;the immediate memory and delay recalling of structure and detail score of RCFT;time of number-letter trail making,shifting time;total time and steps,rule violation of tower of Hanoi improved significantly after OROS methylphenidate treatment as compared with those before treatment.They were no significant differences between ante-and post-treatment. The initiation planning time of tower of Hanoi was significantly shorter after treatment as compared with that before treatment.Conclusion:This study suggests that methylphenidate can improve the executive function in the aspects of inhibition,visual working memory,set shifting and planning in ADHD children,and almost all aspects of EF can reach the normal level except the inhibition.
4.The influence and clinical significance of different pacing modes on central aortic pressure and augmentation index in non-smoking individuals
Shuai MIAO ; Guangping LI ; Lan YE ; Zhehui YAN
Tianjin Medical Journal 2016;44(10):1268-1271
Objective To investigate the influence and clinical significance of single and dual-chamber pacing on central aortic pressure (CAP) and augmentation index (AI) in non-smoking individuals. Methods Totally, 83 non-smokers with pacemaker-implanted were consecutively enrolled in this study, and they were divided into three groups:dual-chamber pacemaker group (DDD, n=35), single-chamber pacemaker group (VVI, n=33) and control group (n=15). Heart rate (HR), CAP, AI, systolic blood pressure (SBP) and diastolic blood pressure (DBP) were measured in three groups of patients. Finally, DDD pacing mode was turned into VVI pacing mode in patients of DDD group and the indexes were measured again. All of the indexes were recorded and analyzed. Results There were no significant changes in baseline characteristics and laboratory data between three groups (P>0.05). Left atrial diameters were significantly higher in VVI group than those of control group (P<0.05). Values of CAP were significantly higher in DDD group than those of control group and VVI group (P<0.05). Values of AI, corrected AI (AIc) and brachial BP were significantly higher in DDD group than those of VVI group (P<0.05). Values of CAP and brachial BP were significantly lower in VVI group than those of control group (P<0.05), while no significant changes were found in AI and AIC between VVI group and control group (P>0.05). All of these indexes (CAP, AI and brachial BP) were significantly reduced after the pacing mode was changed (P<0.05). Conclusion In non-smokers, dual-chamber pacing mode can increase CAP and AI.
5. Research progress on flavonoids and coumarins from Chimonanthus plants and its pharmacological activities
Chinese Traditional and Herbal Drugs 2018;49(14):3425-3431
Chimonanthus plants are endemic in China, which was rich and widely distributed; And its roots, stems, leaves, buds, and fruit can be used as medicine. It is a traditional garden flower and folk medicine, which has a great prospect for development. In this paper, the constituents flavonoids and coumarins from the genus Chimonanthus plants and its pharmacological activities were systematically reviewed, and their research status and development prospects were prospected to provide reference for the further research and development of Chimonanthus plants.
6.Design and synthesis of peptide-drug conjugates and fluorescent probe based on α -conotoxin ArIBV11L,V16D
Xin SUN ; Jiang-nan HU ; Su-lan LUO ; Shuai DONG
Acta Pharmaceutica Sinica 2023;58(9):2727-2733
italic>α-Conotoxin ArIB[V11L,V16D] is currently the most optimal selective inhibitor of α7 nicotinic acetylcholine receptor (nAChR) known. In order to explore chemical modification methods and enrich its application in targeting nAChR, this study utilized the linker to covalently connect camptothecin and 7-amino-4-methylcoumarin to the [2,4] disulfide bond of ArIB[V11L,V16D]. Therefore, two peptide-drug conjugates (PDCs), ArIB[V11L,V16D]-5 and ArIB[V11L,V16D]-6, and one fluorescent-labeled peptide, ArIB[V11L,V16D]-7 were constructed. Cytotoxicity evaluation showed that the IC50 values against non-small cell lung cancer cell line A549 of the two PDCs were respectively 1.3 and 4.1 times of camptothecin, indicating slight reduction in activity at the cellular level which was related to the linker structure. Fluorescence spectrum scanning revealed that the excitation and emission wavelength of the fluorescent-labeled peptide were 340 nm and 403 nm respectively, and the fluorescence features of 7-amino-4-methylcoumarin as a marker were retained without fluorescence quenching. This modification strategy laid a solid foundation for the further application of
7.Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice.
Jiaming LAN ; Shuai LU ; Yao DENG ; Bo WEN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Virology 2016;32(1):77-81
Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.
Animals
;
Antibodies, Viral
;
immunology
;
Computational Biology
;
Coronavirus Infections
;
immunology
;
prevention & control
;
virology
;
Female
;
Humans
;
Immunization
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
immunology
;
Peptides
;
administration & dosage
;
genetics
;
immunology
;
Spike Glycoprotein, Coronavirus
;
administration & dosage
;
genetics
;
immunology
;
Viral Vaccines
;
administration & dosage
;
genetics
;
immunology
8.Study on lentiviral vector target inducing p66 shc gene silencing
Chan ZHANG ; Wenbin DONG ; Shuai ZHAO ; Qingping LI ; Lan KANG ; Xiaoping LEI ; Lin GUO ; Xuesong ZHAI
Chongqing Medicine 2015;(1):73-75,83
Objective To construct p66shc gene interfering lentivirus vectors recombination and transfect it to 293T cells ,RNA interfering was carried out to induce p66shc gene silence ,so as to provide basis for further study of the p66shc function .Methods Screening of three RNA targets which were named after p66shc‐shc1 ,p66shc‐shc2 ,p66shc‐shc3 ,cloned into the pLenR‐GPH vec‐tor ,which contained green fluorescent protein(GFP) and transformed into DH5αcells .The positive clone were picked out for right sequencing and transfected to 293T cells with pRsv‐REV ,pMDlg‐pRRE ,pMD2G .The expression of GFP in inverted fluorescence microscope confirmed the virus packaging success .Fluorescence quantitative PCR and Western blot technology were used to investi‐gate the expression of p66shc at the molecular and protein levels ,p66shc‐shc1 target of effective silencing p66shc gene was selected to prepare for subsequent tests .Results The shRNA lentivirus vector was constructed which could express p66shc and was trans‐fected into 293T cells successfully .Fluorescence quantitative PCR and Western blot technology were used to investigate p66shc gene silence by RNA interference .Conclusion The lentivirus RNAi vector of targeted expression p66shc could induce p66shc gene si‐lence at the molecular and protein levels after transfected into 293T cells by RNA interference .
9.Human umbilical cord mesenchymal stem cells are induced in vitro to differentiate into fibroblasts
Yi YANG ; Xin LUO ; Xuefeng JIANG ; Hanlin SHUAI ; Hong SONG ; Jingli ZHANG ; Jianfa LAN
Chinese Journal of Tissue Engineering Research 2014;(10):1554-1559
BACKGROUND:The umbilical cord mesenchymal stem cells possess multipotent differentiation capacity, but less research focus on its differentiation into fibroblasts.
OBJECTIVE:To investigate the capacity of human umbilical cord mesenchymal stem cells differentiating into fibroblasts.
METHODS:Using adherent method, human umbilical cord mesenchymal stem cells were isolated, and flow cytometric analysis of the surface antigen was performed. Passage 3 cells were selected for osteogenic and
adipogenic differentiation, and cells differentiated into fibroblasts under the induction of basic fibroblast growth factor. RESULTS AND CONCLUSION:Adherent stem cells were stably isolated from the umbilical cord. Human umbilical cord mesenchymal stem cells lowly expressed CD31, CD45, CD40, HLA-DR, but strongly expressed CD29, CD90, CD44, CD105. Oil red O staining showed red droplets were ful of the cytoplasm after adipogenic induction;alizarin red staining showed red calcium nodules after osteogenic induction. After induced by basic fibroblast growth factor, the type I col agen expression was significantly higher than that in the control group. These findings indicate that the adherent human umbilical cord mesenchymal stem cells are reliably isolated with high purity;basic fibroblast growth factor can induce differentiation of umbilical cord mesenchymal stem cells into fibroblasts.
10.The Mutagenic Effect on PHB Accumulation of Acidiphilium cryptum DX1-1
Ai-Ling XU ; Shuai ZHANG ; Yan-Fei ZHANG ; Li LI ; Yu YANG ; Jin-Lan XIA ;
Microbiology 2008;0(10):-
The strain Acidiphilium cryptum DX1-1 producing PHB was irradiated respectively by UV and Co60 to raise PHB production. The results indicated that the effect of UV better than using Co60. One strain of the UV mutagenized called UV60-3 has the highest PHB production yield, showing final PHB concentra- tion of 28.56 g/L, 1.45 times higher than that of original strain. FT-IR spectroscopy analysis shows that the polymers obtained from the strain DX1-1 have the same IR spectra of standard PHB. Further research about the best appropriate C/N ratio of the mutant was done. The optimum ratio of C/N was about 3.76, the final PHB concentration reaches to 30.57 g/L.