1.Chromatin landscape alteration uncovers multiple transcriptional circuits during memory CD8+ T-cell differentiation.
Qiao LIU ; Wei DONG ; Rong LIU ; Luming XU ; Ling RAN ; Ziying XIE ; Shun LEI ; Xingxing SU ; Zhengliang YUE ; Dan XIONG ; Lisha WANG ; Shuqiong WEN ; Yan ZHANG ; Jianjun HU ; Chenxi QIN ; Yongchang CHEN ; Bo ZHU ; Xiangyu CHEN ; Xia WU ; Lifan XU ; Qizhao HUANG ; Yingjiao CAO ; Lilin YE ; Zhonghui TANG
Protein & Cell 2025;16(7):575-601
Extensive epigenetic reprogramming involves in memory CD8+ T-cell differentiation. The elaborate epigenetic rewiring underlying the heterogeneous functional states of CD8+ T cells remains hidden. Here, we profile single-cell chromatin accessibility and map enhancer-promoter interactomes to characterize the differentiation trajectory of memory CD8+ T cells. We reveal that under distinct epigenetic regulations, the early activated CD8+ T cells divergently originated for short-lived effector and memory precursor effector cells. We also uncover a defined epigenetic rewiring leading to the conversion from effector memory to central memory cells during memory formation. Additionally, we illustrate chromatin regulatory mechanisms underlying long-lasting versus transient transcription regulation during memory differentiation. Finally, we confirm the essential roles of Sox4 and Nrf2 in developing memory precursor effector and effector memory cells, respectively, and validate cell state-specific enhancers in regulating Il7r using CRISPR-Cas9. Our data pave the way for understanding the mechanism underlying epigenetic memory formation in CD8+ T-cell differentiation.
CD8-Positive T-Lymphocytes/metabolism*
;
Cell Differentiation
;
Chromatin/immunology*
;
Animals
;
Mice
;
Immunologic Memory
;
Epigenesis, Genetic
;
SOXC Transcription Factors/immunology*
;
NF-E2-Related Factor 2/immunology*
;
Mice, Inbred C57BL
;
Gene Regulatory Networks
;
Enhancer Elements, Genetic
2.Astragalus membranaceus improves therapeutic efficacy of asthmatic children by regulating the balance of Treg/Th17 cells.
Wei WANG ; Qing-Bin LIU ; Wei JING
Chinese Journal of Natural Medicines (English Ed.) 2019;17(4):252-263
Astragalus membranaceus may be a potential therapy for childhood asthma but its driving mechanism remains elusive. The main components of A. membranaceus were identified by HPLC. The children with asthma remission were divided into two combination group (control group, the combination of budesonide and terbutaline) and A. membranaceus group (treatment group, the combination of budesonide, terbutaline and A. membranaceus). The therapeutic results were compared between two groups after 3-month therapy. Porcine peripheral blood mononuclear cells (PBMCs) were isolated from venous blood by using density gradient centrifugation on percoll. The levels of FoxP3, EGF-β, IL-17 and IL-23 from PBMCs and serum IgE were measured. The relative percentage of Treg/Th17 cells was determined using flow cytometry. The main components of A. membranaceus were calycosin-7-O-glucoside, isoquercitrin, ononin, calycosin, quercetin, genistein, kaempferol, isorhamnetin and formononetin, all of which may contribute to asthma therapy. Lung function was significantly improved in the treatment group when compared with a control group (P < 0.05). The efficacy in preventing the occurrence of childhood asthma was higher in the treatment group than the control group (P < 0.05). The levels of IgE, IL-17 and IL-23 were reduced significantly in the treatment group when compared with the control group, while the levels of FoxP3 and TGF-β were increased in the treatment group when compared with the control group (P < 0.05). A. membranaceus increased the percentage of Treg cells and reduced the percentage of Th17 cells. A. membranaceus is potential natural product for improving the therapeutic efficacy of combination therapy of budesonide and terbutaline for the children with asthma remission by modulating the balance of Treg/Th17 cells.
Animals
;
Asthma
;
drug therapy
;
immunology
;
Astragalus propinquus
;
chemistry
;
Budesonide
;
administration & dosage
;
Cells, Cultured
;
Child
;
Child, Preschool
;
Cytokines
;
metabolism
;
Drugs, Chinese Herbal
;
administration & dosage
;
pharmacology
;
Female
;
Humans
;
Immunologic Factors
;
administration & dosage
;
pharmacology
;
Leukocytes, Mononuclear
;
drug effects
;
metabolism
;
Lung
;
drug effects
;
physiology
;
Male
;
Swine
;
T-Lymphocytes, Regulatory
;
cytology
;
drug effects
;
Terbutaline
;
administration & dosage
;
Th17 Cells
;
cytology
;
drug effects
;
Treatment Outcome
3.Immune Homeostasis: Effects of Chinese Herbal Formulae and Herb-Derived Compounds on Allergic Asthma in Different Experimental Models.
Lu LIU ; Lin-Peng WANG ; Shan HE ; Yan MA
Chinese journal of integrative medicine 2018;24(5):390-398
Allergic asthma is thought to arise from an imbalance of immune regulation, which is characterized by the production of large quantities of IgE antibodies by B cells and a decrease of the interferon-γ/interleukin-4 (Th1/Th2) ratio. Certain immunomodulatory components and Chinese herbal formulae have been used in traditional herbal medicine for thousands of years. However, there are few studies performing evidence-based Chinese medicine (CM) research on the mechanisms and effificacy of these drugs in allergic asthma. This review aims to explore the roles of Chinese herbal formulae and herb-derived compounds in experimental research models of allergic asthma. We screened published modern CM research results on the experimental effects of Chinese herbal formulae and herb-derived bioactive compounds for allergic asthma and their possible underlying mechanisms in English language articles from the PubMed and the Google Scholar databases with the keywords allergic asthma, experimental model and Chinese herbal medicine. We found 22 Chinese herb species and 31 herb-derived anti-asthmatic compounds as well as 12 Chinese herbal formulae which showed a reduction of airway hyperresponsiveness, allergen-specifific immunoglobulin E, inflflammatory cell infifiltration and a regulation of Th1 and Th2 cytokines in vivo, in vitro and ex vivo, respectively. Chinese herbal formulae and herbderived bioactive compounds exhibit immunomodulatory, anti-inflflammatory and anti-asthma activities in different experimental models and their various mechanisms of action are being investigated in modern CM research with genomics, proteomics and metabolomics technologies, which will lead to a new era in the development of new drug discovery for allergic asthma in CM.
Animals
;
Asthma
;
complications
;
drug therapy
;
immunology
;
Disease Models, Animal
;
Drugs, Chinese Herbal
;
therapeutic use
;
Homeostasis
;
Hypersensitivity
;
complications
;
drug therapy
;
immunology
;
Immunologic Factors
;
therapeutic use
4.Clinical Development of Immunotherapy for Small Cell Lung Cancer.
Chinese Journal of Lung Cancer 2018;21(12):918-923
Small cell lung cancer (SCLC), which accounts for about 15% of lung cancer cases, is an aggressive disease characterized by rapid growth and early widespread metastasis. Despite sensitive to chemotherapy and radiotherapy, SCLC is vulnerable to get resistant and has high recurrence rates. In recent years, immunotherapy has shown good antitumor activity, especially programmed death receptor-1/ligand-L1 (PD-1/L1) and cytotoxic T-lymphocyte-associated antigen-4 (CTLA-4) Checkpoint inhibitors have changed the pattern of tumor treatment, and SCLC has high immunogenicity, high mutation load and other favorable immune factors, so immuno-checkpoint inhibitors may become an important breakthrough in SCLC treatment. This article will briefly review the clinical research of immunotherapy for small cell lung cancer.
.
Humans
;
Immunologic Factors
;
genetics
;
immunology
;
Immunotherapy
;
methods
;
trends
;
Lung Neoplasms
;
genetics
;
immunology
;
therapy
;
Programmed Cell Death 1 Receptor
;
genetics
;
immunology
;
Small Cell Lung Carcinoma
;
genetics
;
immunology
;
therapy
5.Effect of methotrexate on regulation for the number of regulatory T cells and expression of Foxp3 in psoriasis.
Yehong KUANG ; Heng ZHANG ; Wu ZHU ; Lisha WU ; Wangqing CHEN ; Yan LU ; Qunshi QIN ; Xuekun JIA ; Liqiu LIAO
Journal of Central South University(Medical Sciences) 2018;43(8):835-842
To explore the role of methotrexate (MTX) in regulating the number of regulatory T cells (Treg) and the mRNA expression of transcription factor Foxp3.
Methods: 1) We analyzed the number of Treg and the mRNA expression of Foxp3 by flow cytometry (FCM) and quantitative real-time PCR (qRT-PCR) respectively in patients with psoriasis vulgaris, patients with psoriasis vulgaris after the 8-week treatment of MTX, and healthy people. 2) BALB/c female mice were smeared with imiquimod (IMQ) cream for 6 days. We recorded the change of the lesion in mice every day. The morphological changes of lesion in mice were evaluated by the psoriasis area and severity index (PASI) and HE staining. 3) The mouse model was randomly divided into a control group and an MTX group. The MTX group was treated with different doses of MTX (38.5 and 77.0 nmol/L) on the third day of this experiment. The morphological changes of lesion in mice were evaluated by PASI and HE staining. We tested the number of Treg and the expression level of Foxp3 mRNA in splenic lymphocytes.
Results: 1) The number of Treg and the expression level of Foxp3 mRNA were lower in psoriasis vulgaris patients than those in the healthy control group (P<0.05). After 8-week treatment of MTX, the number of Treg was increased (P<0.05) and Foxp3 mRNA level was up-regulated (P<0.01). 2) Typical psoriasis-like skin lesions, such as red scaly skin plaque were found after topical application of IMQ. Both the number of Treg in the splenic lymphocytes of mice and the Foxp3 mRNA level of Treg were reduced by IMQ (P<0.01 and P<0.05). 3) Different doses of MTX for mice showed the ability to improve skin lesion, increase the number of Treg in the spleen of mice and Foxp3 mRNA level in psoriatic dermatitis of mice (P<0.05).
Conclusion: MTX is able to regulate the number of Treg and Foxp3 mRNA expression in psoriasis.
Adjuvants, Immunologic
;
pharmacology
;
Aminoquinolines
;
pharmacology
;
Animals
;
Case-Control Studies
;
Female
;
Forkhead Transcription Factors
;
metabolism
;
Humans
;
Imiquimod
;
Immunosuppressive Agents
;
administration & dosage
;
pharmacology
;
Lymphocyte Count
;
Methotrexate
;
administration & dosage
;
pharmacology
;
Mice
;
Mice, Inbred BALB C
;
Psoriasis
;
drug therapy
;
immunology
;
metabolism
;
pathology
;
RNA, Messenger
;
metabolism
;
Random Allocation
;
Spleen
;
cytology
;
T-Lymphocytes, Regulatory
;
cytology
;
drug effects
;
metabolism
6.Intravenous immunoglobulin G in women with reproductive failure: The Korean Society for Reproductive Immunology practice guidelines.
Nayoung SUNG ; Ae Ra HAN ; Chan Woo PARK ; Dong Wook PARK ; Joon Cheol PARK ; Na Young KIM ; Kyung Sil LIM ; Ji Eun SHIN ; Chang Woo JOO ; Seung Eun LEE ; Jae Won KIM ; Sung Ki LEE
Clinical and Experimental Reproductive Medicine 2017;44(1):1-7
The task force of the Korean Society for Reproductive Immunology recommends intravenous immunoglobulin G treatment in women with reproductive failure, including recurrent pregnancy loss and/or repeated implantation failure, who show cellular immune factors such as abnormal natural killer cell levels, natural killer cell cytotoxicity, and/or type 1 T helper immunity.
Abortion, Habitual
;
Advisory Committees
;
Allergy and Immunology*
;
Female
;
Humans
;
Immunoglobulin G*
;
Immunoglobulins*
;
Immunologic Factors
;
Infertility
;
Killer Cells, Natural
;
Pregnancy
7.New monoclonal antibody-based test for Helicobacter pylori urease in gastric tissue.
Do Hyun KIM ; Ho Dong KIM ; Hyeuk PARK ; Seung CHOI ; Jae Won BEOM ; Woo Jong KIM ; Chang Kook PARK ; Young Jik LEE ; Ju Young PARK ; Hyung Rag KIM ; Chul PARK ; Young Eun JOO ; Young Do JUNG
The Korean Journal of Internal Medicine 2016;31(1):40-45
BACKGROUND/AIMS: To evaluate a new monoclonal antibody for Helicobacter pylori urease in gastric tissue. METHODS: A total of 107 volunteers were enrolled. All subjects underwent a 13C-urea breath test and esophagogastroduodenoscopy. Gastric aspirates were analyzed for pH and ammonia. Six biopsy specimens in the gastric antrum and body were obtained for a rapid urease test and histology. The new monoclonal antibody-based H. pylori urease test (HPU) was performed to rapidly and qualitatively detect urease in two biopsy specimens. RESULTS: H. pylori infection was diagnosed in 73 subjects. The sensitivity and specificity of the HPU was 89% and 74%, respectively. The subjects were divided into two groups: one with true-positive and true-negative HPU results (n = 90) and the other with false-positive and false-negative HPU results (n = 17). Across all subjects, ammonia levels were 900.5 +/- 646.7 and 604.3 +/- 594.3 mumol/L (p > 0.05), and pH was 3.37 +/- 1.64 and 2.82 +/- 1.51 (p > 0.05). Sensitivity was higher in the presence of atrophic gastritis or intestinal metaplasia. CONCLUSIONS: HPU detected H. pylori in approximately 10 min. Gastric aspirate ammonia and pH levels did not affect the test results. Sensitivity was good in the presence of atrophic gastritis or intestinal metaplasia.
Adult
;
Antibodies, Monoclonal/*immunology
;
Bacterial Proteins/*analysis/immunology
;
Biomarkers/analysis
;
Biopsy
;
False Negative Reactions
;
False Positive Reactions
;
Female
;
Gastritis, Atrophic/*diagnosis/microbiology
;
Helicobacter Infections/*diagnosis/microbiology
;
Helicobacter pylori/*enzymology/immunology
;
Humans
;
*Immunologic Tests
;
Male
;
Metaplasia
;
Middle Aged
;
Predictive Value of Tests
;
Pyloric Antrum/*microbiology/pathology
;
Reproducibility of Results
;
Time Factors
;
Urease/*analysis/immunology
;
Workflow
8.Non-Paraneoplastic Autoimmune Retinopathy: The First Case Report in Korea.
Eun Young CHOI ; Min KIM ; Grazyna ADAMUS ; Hyoung Jun KOH ; Sung Chul LEE
Yonsei Medical Journal 2016;57(2):527-531
Autoimmune retinopathy (AIR) is an immune-mediated retinopathy, resulting from an immunologic process caused by the aberrant recognition of retinal antigens as autoantigens. The diagnosis of AIR involves the detection of antiretinal antibodies with concurrent clinical and electrophysiological evidence of retinopathy. A 40-year-old patient presented with progressive loss of bilateral vision over several months. A fundus examination was unremarkable. Spectral domain optical coherence tomography revealed a blurred photoreceptor ellipsoid zone at the subfoveal region in both eyes with more prominent disruption in the left eye. Full-field electroretinography (ERG) showed relatively normal rod and cone responses in the right eye, and decreased photopic bwaves with minimal attenuation of a-waves in the left eye. Multifocal ERG demonstrated slightly reduced amplitude of the inner segment ring in the right eye and decreased amplitudes and delayed latencies of all modalities in the left eye. The patient was suspected to have AIR and it was supported by positive Western blots for 23-kDa protein, enolase (46-kDa), aldolase (40-kDa), 62-kDa and 78-kDa proteins and by immunohistochemical staining of human retinal bipolar and ganglion cells. Despite the immunosuppressive treatment, the destruction of the retinal photoreceptors progressed, and immunosuppressive interventions produced very little visual improvement. We report on what is, to the best of our knowledge, the very first case of serologically confirmed nonparaneoplastic AIR in Korea.
Autoantibodies/*blood/immunology
;
Autoantigens
;
Autoimmune Diseases/*immunology
;
Electroretinography
;
Humans
;
Immunologic Factors
;
Paraneoplastic Syndromes/*immunology
;
Paraneoplastic Syndromes, Ocular
;
Phosphopyruvate Hydratase
;
Recoverin
;
Republic of Korea
;
Retina/*immunology
;
Retinal Diseases/*immunology
;
Tomography, Optical Coherence
9.Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris.
Wei-Hui LIU ; Yan CHEN ; Xue-Wei BAI ; Hui-Min YAO ; Xu-Guang ZHANG ; Xiu-Wen YAN ; Ren LAI
Chinese Journal of Natural Medicines (English Ed.) 2016;14(9):677-682
The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.
Amino Acid Sequence
;
Animals
;
Immunologic Factors
;
administration & dosage
;
chemistry
;
genetics
;
Inflammation
;
drug therapy
;
immunology
;
Interferon-gamma
;
immunology
;
Interleukin-6
;
immunology
;
Leeches
;
chemistry
;
Mass Spectrometry
;
Mice
;
Molecular Sequence Data
;
Neuropeptide Y
;
administration & dosage
;
chemistry
;
genetics
;
Peptide Mapping
;
Salivary Glands
;
chemistry
;
Tumor Necrosis Factor-alpha
;
immunology
10.A polysaccharide purified from Radix Adenophorae promotes cell activation and pro-inflammatory cytokine production in murine RAW264.7 macrophages.
Jing-Wen LI ; Yang LIU ; Bao-Hui LI ; Yue-Yang WANG ; Hui WANG ; Chang-Lin ZHOU
Chinese Journal of Natural Medicines (English Ed.) 2016;14(5):370-376
Radix Adenophorae, a traditional Chinese medicine, has been reported to have a variety of biological functions. In the present study, a polysaccharide component, Radix Adenophorae Polysaccharide (RAPS), was purified from Radix Adenophorae by decoloring with ADS-7 macroporous adsorption resin, DEAE-52 cellulose ion-exchange chromatography, and Sephacryl S-300HR gel chromatography, with the purity of 98.3% and a molecular weight of 1.8 × 10(4) Da. The cell viability assay and microscopic examination revealed that RAPS promoted the proliferation and activation of macrophages. At 400 μg·mL(-1), RAPS stimulated RAW264.7 cell proliferation by 1.91-fold compared with the control. Meanwhile, RAPS significantly increased the secretion of pro-inflammatory cytokines (TNF-α and IL-6) in a dose-dependent manner in the supernatant of RAW264.7 cell culture as determined by ELISA. At 400 μg·mL(-1), the production of TNF-iα was 20.8-fold higher than that of the control. Simultaneously, the production of nitric oxide (NO) and the expression of inducible nitric oxide synthase (iNOS) were increased in RAW264.7 cells incubated with RAPS, as measured by Griess assay and Western blot analysis. The NO production of cells treated with RAPS (400 μg·mL(-1)) reached 15.8 μmol·L(-1), which was 30.4-fold higher than that of the control (0.53 μmol·L(-1)). These data suggested that RAPS may enhance the immune function and protect against exogenous pathogens by activating macrophages.
Animals
;
Campanulaceae
;
chemistry
;
Cytokines
;
genetics
;
immunology
;
Immunologic Factors
;
pharmacology
;
Interleukin-6
;
genetics
;
immunology
;
Macrophage Activation
;
drug effects
;
Macrophages
;
drug effects
;
immunology
;
Mice
;
Nitric Oxide
;
immunology
;
Plant Extracts
;
pharmacology
;
Polysaccharides
;
pharmacology
;
Tumor Necrosis Factor-alpha
;
genetics
;
immunology

Result Analysis
Print
Save
E-mail