1.Effectiveness of integrative medicine for preventing postoperative recurrence of primary hepatic carcinomas: a systematic review.
Zi-yao CHEN ; Jian LIANG ; Xin DENG
Chinese Journal of Integrated Traditional and Western Medicine 2014;34(6):671-675
OBJECTIVETo systematically evaluate the effectiveness of integrative medicine (IM) for preventing postoperative recurrence of primary hepatic carcinomas (PHC).
METHODSSuch databases as The Cochrane Library, PubMed, EMbase, China National Knowledge Infrastructure (CNKI), VIP Database, Wan-fang Database were retrieved to collect randomized controlled trials (RCTs) on preventing postoperative recurrence of PHC by IM. The retrieval period started from database establishment to June 2013. Literature screening, data extraction, and quality evaluation were performed by two reviewers strictly according to inclusion criteria. Meta-analysis was conducted using RevMan 5.2 Software.
RESULTSA total of 5 RCTs involving 367 patient cases were included. Results of Meta-analysis showed that the IM group was superior to the Western medicine (WM) group in the 1-, 2-, and 3-year recurrence rates (P < 0.05).
CONCLUSIONIn the prevention of postoperative recurrence of PHC, the effectiveness of IM was more significant, when compared with treatment of Western medicine.
Drugs, Chinese Herbal ; therapeutic use ; Humans ; Integrative Medicine ; Liver Neoplasms ; prevention & control ; Neoplasm Recurrence, Local ; prevention & control ; Postoperative Period ; Randomized Controlled Trials as Topic ; Treatment Outcome
2.Effect of group psychotherapy on the alleviation of psychiatric nurses' compassion fatigue
Chunyan CHEN ; Xiaorong YANG ; Aiping DENG ; Meiqing WU ; Yao CHEN
Chinese Journal of Practical Nursing 2015;31(16):1227-1229
Objective To explore the influence of group psychotherapy on the alleviation of psychiatric nurses' compassion fatigue.Methods A total of 190 psychiatric nurses were investigated by compassion fatigue scale.Forty psychiatric nurses were selected to accept group psychotherapy for 10 times.The scores of compassion fatigue scale were compared before and after group psychotherapy and the influencing factors of therapeutic effect were analyzed.Results Thirty-eight psychiatric nurses had accomplished the intervention and follow-up.Compared with before group psychotherapy,the total scores of compassion fatigue scale and the scores of mental tension,passive behavior,doubtful ability and loss of morale among 6 dimensions after group psychotherapy were improved:(83.28±7.01) scores vs.(102.60±7.24) scores,(2.66±0.42) scores vs.(3.11±0.49) scores,(2.02±0.36) scores vs.(2.55±0.41) scores,(1.99±0.33)scores vs.(2.65±0.38) scores,(1.69±0.34) scores vs.(2.76±0.44) scores,and there were significant differences,P<0.05.Regression analysis found that the work life,education level were correlated with the deduction rate of the total scores of compassion fatigue scale,t=2.858,3.099,P<0.01.Conclusion Group psychotherapy can help psychiatric nurses to alleviate their compassion fatigue.
3.Surface electromyogram denoising using adaptive wavelet thresholding.
Zhi LOU ; Deng HAO ; Xiang CHEN ; Bo YAO ; Jihai YANG
Journal of Biomedical Engineering 2014;31(4):723-728
Surface electromyogram (sEMG) may have low signal to noise ratios. An adaptive wavelet thresholding technique was developed in this study to remove noise contamination from sEMG signals. Compared with convention- al wavelet thresholding methods, the adaptive approach can adjust thresholds based on different signal to noise ratios of the processed signal, thus effectively removing noise contamination and reducing distortion of the EMG signal. The advantage of the developed adaptive thresholding method was demonstrated using simulated and experimental sEMG recordings.
Algorithms
;
Electromyography
;
Humans
;
Signal Processing, Computer-Assisted
;
Wavelet Analysis
4.The role of D-lactate gradient across the lung in the diagnosis and therapeutic evaluation of pneumonia
Yunming CHEN ; Liehua DENG ; Yuanli ZHANG ; Juan LI ; Huaguo YAO
Chongqing Medicine 2015;(31):4355-4357,4360
Objective To study the role of D‐lactate gradient across the lung in the rapid diagnosis of pneumonia and evalua‐tion of therapeutic efficacy .Methods Patients were divided into pneumonia group (n=46) and non‐pneumonia group (n=28) in ICU .D‐lactate gradient across the lung were calculated by the difference between arterial and mixed‐venous D‐lactate concentrations before the treatment ,after 3 and 7 days of treatment .Serum procalcitonin (PCT) ,Oxygenation index ,the lung injury score (LIS) and clinical pulmonary infection score(CPIS) were recorded at the same time .Results The mean D‐lactate gradient across the lung in pneumonia group was significantly higher than that in non‐pneumonia group[(163 .84 ± 10 .72) ng/mL vs .(30 .33 ± 7 .25) ng/mL ,P<0 .01) ]before treatment .Using a cut‐off value of 106 .11 ng/mL ,D‐lactate gradient across the lung′s sensitivity for di‐agnosis pneumonia was 90 .7% and its′specificity was 75 .5% .D‐lactate gradient across the lung correlated with LIS (r= 0 .554 , P<0 .01) and CPIS(r=0 .543 ,P<0 .01) .Conclusion D‐lactate gradient across the lung correlates with lung injury and pulmonary infection positively and may be a potential biomarker for rapid diagnosis of pneumonia .
5.Extraction and purification of Jo-1 antigen
Caizhong ZHU ; Hua CHEN ; Xuexin DENG ; Fulin TANG ; Zhijian YAO
Basic & Clinical Medicine 2006;0(10):-
Objective To improve the purifying method of Jo-1 antigen from rabbit thymus used for detection of anti-Jo-1 antibody by dot-blotting immunoassay(DB).Methods The rabbit thymus glands were cut into pieces,homogenized and extracted by PBS.Total protein was precipitated by acetone to get acetone powder(RTAP).The RTAP was solved in PBS and separated by an by anti-Jo-1 IgG affinity column.Results 5~7 g RTAP was obtained from 100g rabbit thymus glands.There was 19%~24% of protein in RTAP.Jo-1 antigen was enriched around 1900 folds through affinity chromatography,with 2.5% recovery of antigenic activity.In this preparation,there were several bands on SDS-PAGE,but only one band about 50 ku,reacted with anti-Jo-1 antisera on immunoblotting.Dot-blotting also showed that the antigen only reacted with Jo-1 antisera.The purified Jo-1 antigen was not stable for long time,but the antigenic activity could maintain for a long time when there was MgCl2 in the solution.Conclusion Affinity chromatography was a simple and easy method for purifying Jo-1 antigen from rabbit thymus.The antigen purified by affinity chromatography could meet the requirement for detecting Jo-1 antibody bydot-blotting.
7.Middle-column preserved pedicle subtraction closing-opening wedge osteotomy for the treatment of stiff kyphosis
Bo DENG ; Yao CHEN ; Zhenghua HONG ; Zhangfu WANG ; Xinbin FENG ; Weifu CHEN ; Haixiao CHEN
Chinese Journal of Orthopaedics 2021;41(1):8-17
Objective:To investigate the effectiveness and safety of middle-column preserved pedicle subtraction closing-opening wedge osteotomy for the treatment of stiff kyphosis.Methods:From January 2016 to April 2018, 12 patients with stiff kyphosis in our department were treated with middle-column preserved pedicle subtraction closing-opening wedge osteotomy. The patients' operative time, intraoperative blood loss, postoperative drainage, surgical complications, low back pain and leg pain visual analogue scale (VAS), Oswestry dysfunction index (ODI) score, and SF-36 were recorded.These parameters were compared at preoperative, postoperative, and at the final follow-up. Coronal parameters included lumbar scoliosis Cobb angle, C 7 vertebral body center to humeral vertical line distance (C 7PL-CSVL), whilesagittal parameters includedlumbar Lordosis (LL), sacral slope (SS), pelvic tilt (PT), and sagittalvertical axis (SVA). Results:All of 12 patients successfully completed the operation.The mean operation time was 238.20±65.95 min, the mean intraoperative blood loss was 440.50±133.60 ml.The patients’ODI score was 65.92%±6.96% at the preoperative, and 21.00%±3.19% at the final follow-up. The difference was statistically significant ( t=20.32, P<0.0001).The VAS score of back pain was 6.00±0.95 at preoperative, 2.33±0.89 at 3 months postoperatively, and 1.42±0.51 at the final follow-up. The VAS score of leg pain was 6.91±1.24 at preoperative, 2.50±1.00 at 3 months postoperatively, and1.50±0.52 at the final follow-up. There was significant difference in SF-36 at preoperative and at final follow-up ( P<0.05). The differences in LL, SS, PT and SVA at the preoperative and at final follow-up were statistically significant ( F=17.47, P<0.001; F=5.015, P=0.0125; F=14.66, P<0.001; F=81.11, P<0.001) . There was significant difference in lumbar scoliosis Cobb angle and C 7PL-CSVL at the preoperative and at final follow-up ( F=87.19, P<0.001; F=100.9, P<0.001) . Conclusion:The advantages of this surgical procedure includesimple operation, reducedsurgery time, and shorten intraoperative bleeding, which can effectively relief clinical symptoms, improve the quality of life, correctkyphosis, and maintain the patient's spinal-pelvic balance.
8.Genomic evolution characteristics of pathogenicity islands of enteropatho-genic Escherichia coli Deng strain
Zhong CHEN ; Jinxin ZHENG ; Weizhi YANG ; Hongyan WANG ; Weiming YAO ; Xiangbin DENG ; Duoyun LI ; Xiaojun LIU ; Zhijian YU ; Qiwen DENG
Chinese Journal of Infection Control 2016;(1):1-9
Objective To analyze the genomic evolution characteristics of pathogenicity islands (PAIs)in Deng strain of enteropathogenic Escherichia coli (E.coli,EPEC Deng).Methods EPEC Deng was isolated from infant stool specimen,serotypes were identified and antimicrobial susceptibility testing was performed;whole-genome se-quencing was performed by Illumina 2000 system,the locations of prophages(PPs)in the chromosome were detected using PHAST software,collinearity analysis was performed by MUMmer software,phylogenetic trees of homolo-gous gene were constructed in order to understand the evolutional rule of homology gene.PAIs prediction was per-formed using PAI finder software,the homologous evolutionary rule of PAIs core region(LEE)and core genes were clarified,genetic polymorphism was analyzed.Results The serotype of EPEC Deng strain was O119:H6,the strain was resistant to ciprofloxacin,levofloxacin,and ampicillin,but sensitive to other antimicrobial agents.The complete circular chromosome contained 5 025 482 bp with a GC content of 50.52 %,and the plasmid contained 207 564 bp with a GC content of 49.50%.A total of 17 PPs in the chromosomal genome were discovered,phyloge-netic trees analysis suggested that EPEC Deng strain was highly homologous with O26:H11 and O111 :H strains;PAIs and core genes were highly homologous with RDEC-1 and O26:H413/89-1 strains;genetic diversity analysis showed that the intimin (eae)and its receptor tir had high polymorphism,with the pi (π)value>0.10,the genes in type III secretion system was relatively stable.Conclusion The study clarified the genomic evolution characteris-tics of EPEC Deng genome and it’s PAIs,and is helpful for understanding genetic characteristics of native EPEC.
9.Immunogenicity and heterologous protection in mice with a recombinant adenoviral-based vaccine carrying a hepatitis C virus truncated NS3 and core fusion protein.
Jie GUAN ; Yao DENG ; Hong CHEN ; Yang YANG ; Bo WEN ; Wenjie TAN
Chinese Journal of Virology 2015;31(1):7-13
To develop a safe and broad-spectrum effective hepatitis C virus (HCV) T cell vaccine,we constructed the recombinant adenovirus-based vaccine that carried the hepatitis C virus truncated NS3 and core fusion proteins. The expression of the fusion antigen was confirmed by in vitro immunofluorescence and western blotting assays. Our results indicated that this vaccine not only stimulated antigen-specific antibody responses,but also activated strong NS3-specific T cell immune responses. NS3-specific IFN-γ+ and TNF-α+ CD4+ T cell subsets were also detected by a intracellular cytokine secretion assay. In a surrogate challenge assay based on a recombinant heterologous HCV (JFH1,2a) vaccinia virus,the recombinant adenovirus-based vaccine was capable of eliciting effective levels of cross-protection. These findings have im- portant implications for the study of HCV immune protection and the future development of a novel vaccine.
Adenoviridae
;
genetics
;
metabolism
;
Animals
;
CD4-Positive T-Lymphocytes
;
immunology
;
Cross Protection
;
Female
;
Genetic Vectors
;
biosynthesis
;
genetics
;
Hepacivirus
;
genetics
;
immunology
;
Hepatitis C
;
immunology
;
prevention & control
;
virology
;
Humans
;
Interferon-gamma
;
immunology
;
Mice
;
Mice, Inbred BALB C
;
Recombinant Proteins
;
administration & dosage
;
genetics
;
immunology
;
Viral Core Proteins
;
administration & dosage
;
genetics
;
immunology
;
Viral Hepatitis Vaccines
;
administration & dosage
;
genetics
;
immunology
;
Viral Nonstructural Proteins
;
administration & dosage
;
genetics
;
immunology
10.Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice.
Jiaming LAN ; Shuai LU ; Yao DENG ; Bo WEN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Virology 2016;32(1):77-81
Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.
Animals
;
Antibodies, Viral
;
immunology
;
Computational Biology
;
Coronavirus Infections
;
immunology
;
prevention & control
;
virology
;
Female
;
Humans
;
Immunization
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
immunology
;
Peptides
;
administration & dosage
;
genetics
;
immunology
;
Spike Glycoprotein, Coronavirus
;
administration & dosage
;
genetics
;
immunology
;
Viral Vaccines
;
administration & dosage
;
genetics
;
immunology