1.Biomechanical study of improved memory alloy embracing fixators in treatment of periprosthetic femoral fracture due to hip arthroplasty
Qiang SUN ; Yao LU ; Hongxun WANG ; Shuai XIANG
Chinese Journal of Trauma 2015;31(7):637-640
Objective To study the mechanics of improved memory alloy fixators for salvage of periprosthetic femoral fracture (PFF) after hip arthroplasty in the elderly.Methods Thirty countrymen fresh cadaveric femurs with no pathological defect,fracture,deformity or tumor were randomly divided into experimental group and control group with 15 femurs in each according to the random number table.A model of Vancouver type B1 periprosthetic femoral fracture following hip arthroplasty was induced.The fracture was treated with modified memory alloy embracing fixators in experimental group;instead general memory alloy embracing fixators in control group.All specimens were tested biomechanically.Results Under the same mechanical loading,the two groups showed respective 30% and 48% maximum differences in stress value and displacement.Results in three-point bending test did not differ significantly between the two groups (P > 0.05),but there were significant differences in axial compression and torsion test (P < 0.05 or 0.01).Conclusion The improved memory alloy embracing fixators present better resistance to compression and torsion compared to the general fixators.
2.Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice.
Jiaming LAN ; Shuai LU ; Yao DENG ; Bo WEN ; Hong CHEN ; Wen WANG ; Wenjie TAN
Chinese Journal of Virology 2016;32(1):77-81
Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.
Animals
;
Antibodies, Viral
;
immunology
;
Computational Biology
;
Coronavirus Infections
;
immunology
;
prevention & control
;
virology
;
Female
;
Humans
;
Immunization
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
immunology
;
Peptides
;
administration & dosage
;
genetics
;
immunology
;
Spike Glycoprotein, Coronavirus
;
administration & dosage
;
genetics
;
immunology
;
Viral Vaccines
;
administration & dosage
;
genetics
;
immunology
3.Clinical and Biological Character in Mouse Models for Middle East Respiratory Syndrome Generated by Transduction with Different Doses of DPP4 Molecule.
Yanfeng YAO ; Jiaming LAN ; Fengdi LI ; Peihua NIU ; Pin YU ; Lu SHUAI ; Linlin BAO ; Wenjie TAN ; Chuan QIN
Chinese Journal of Virology 2015;31(6):593-600
In this study, we evaluated the difference ot biological characteristics in the MERS-CoV infected mice model in prior to transduction with different dosage of human DPP4. Firstly, we transduced different dosage of DPP4 (high or low) into mice, and then challenged them with MERS-CoV in order to establish the model. After establishment of mice model, we observed the clinical signs of disease, virus replication, immunopathogenesis and antibody response. The results indicated that the infected mice showed typical pneumonia, virus replication, histological lesions, and neutralizing antibody production. Moreover, the high dosage group was superior to the low dosage group. Fourteen days after infection, the specific antibody to virus structural protein and neutralizing antibody were analyzed, the high dosage group induced higher level antibody. In summary, the MERS-CoV infected mice model were established prior transduction with DPP4, and the level of DPP4 influenced the clinical signs of disease, virus replication and antibody response in this model.
Animals
;
Coronavirus Infections
;
enzymology
;
genetics
;
pathology
;
virology
;
Dipeptidyl Peptidase 4
;
genetics
;
metabolism
;
Disease Models, Animal
;
Female
;
Humans
;
Mice
;
Mice, Inbred BALB C
;
Middle East Respiratory Syndrome Coronavirus
;
genetics
;
physiology
4.Study of hCTGF Repair on Bone Injury
Ming SUN ; Zhang-Long HE ; Jing-Jing WANG ; Shuai-Yao LU ; Li-Chun WANG ; Yuan ZHAO ; Qi-Han LI ;
China Biotechnology 2006;0(11):-
Object: To study the proliferation of hCTGF on cells and its biological function on bone injury healing.Methods: The fibroblast with potential differentiation was transfected by eukaryotic gene delivery system and then transferred into the experimental animal model with bone fracture.The data were collected by molecular biological and clinical orthopedic technique detection analysis.Results: The results demonstrated an obvious proliferation of hCTGF on cells,suggesting that hCTGF have the biological activity of repairing bone injury via gene therapy.The results provide a new activity factor and treatment approach for bone injury in clinics.
5.Effects of acute pancreatitis mouse model induced by caerulein and lipopolysaccharides
yao Lu XIAO ; Jie ZHANG ; gang Zhi XU ; Shuai ZHENG ; shuai Shao MEI
Basic & Clinical Medicine 2017;37(10):1384-1388
Objective To observe the time dependent changes of pancreas and lung injury in mice acute pancrea-titis induced by caerulein,and compare the effects of mice acute pancreatitis model induced by different injection protocols of caerulein and lipopolysaccharides. Methods Acute pancreatitis were induced by different injection frequency of caerulein or caerulein combined with lipopolysaccharides, and plasma amylase activity was detected by starch-iodine colorimetry,and pancreas and lung injury severity was observed on paraffin section after HE stai-ning. Results The injury of pancreas and lung in mice acute pancreatitis induced by caerulein was most severe at 4 h, which began to repair at 24 h, and basically returned to normal at 5 d. 4 h after last injection, the amylase activity in CAE7 group and CAE9 group was higher than that in the control group(6 461±1 078 U/dl vs 3 093± 331 U/dl;6 821 ± 495 U/dl vs 3 093 ± 331 U/dl, all P<0.001), and CAE7+LPS group was higher than in CAE9 group[(8 912±465)U/dl vs (6 821±495)U/dl,P<0.001],the histological score in CAE7 group and CAE9 group was higher than that in the control group(4.750 ± 0.524 vs 0 ± 0; 4.917 ± 0.664 vs 0 ± 0, all P<0.001), and that in CAE7+LPS group was higher than in CAE9 group(7.167 ± 0.258 vs 4.917 ± 0.664, P<0.001). Conclusions Mice acute pancreatitis can be successfully induced by 7 i.p. injections of caerulein (50 μg/kg body weight) at 1-hour intervals,caerulein combined with lipopolysaccharides.
6.Effects of acute pancreatitis mouse model induced by caerulein and lipopolysaccharides
yao Lu XIAO ; Jie ZHANG ; gang Zhi XU ; Shuai ZHENG ; shuai Shao MEI
Basic & Clinical Medicine 2017;37(10):1384-1388
Objective To observe the time dependent changes of pancreas and lung injury in mice acute pancrea-titis induced by caerulein,and compare the effects of mice acute pancreatitis model induced by different injection protocols of caerulein and lipopolysaccharides. Methods Acute pancreatitis were induced by different injection frequency of caerulein or caerulein combined with lipopolysaccharides, and plasma amylase activity was detected by starch-iodine colorimetry,and pancreas and lung injury severity was observed on paraffin section after HE stai-ning. Results The injury of pancreas and lung in mice acute pancreatitis induced by caerulein was most severe at 4 h, which began to repair at 24 h, and basically returned to normal at 5 d. 4 h after last injection, the amylase activity in CAE7 group and CAE9 group was higher than that in the control group(6 461±1 078 U/dl vs 3 093± 331 U/dl;6 821 ± 495 U/dl vs 3 093 ± 331 U/dl, all P<0.001), and CAE7+LPS group was higher than in CAE9 group[(8 912±465)U/dl vs (6 821±495)U/dl,P<0.001],the histological score in CAE7 group and CAE9 group was higher than that in the control group(4.750 ± 0.524 vs 0 ± 0; 4.917 ± 0.664 vs 0 ± 0, all P<0.001), and that in CAE7+LPS group was higher than in CAE9 group(7.167 ± 0.258 vs 4.917 ± 0.664, P<0.001). Conclusions Mice acute pancreatitis can be successfully induced by 7 i.p. injections of caerulein (50 μg/kg body weight) at 1-hour intervals,caerulein combined with lipopolysaccharides.
7.Studies on the infection status of seven species Mycoplasma, three species of Chlamydia, Neisseria gonorrhoeae and Garderella vaginalis in 76 patients with sexual transmitted diseases.
Rong SUN ; Feng SUN ; Yao TANG ; Jian-jian GU ; Xin-hua ZHANG ; Lu-xin ZHENG ; Zhu-shuai SHI
Chinese Journal of Epidemiology 2004;25(2):146-149
OBJECTIVETo study the infectious status of seven species of Mycoplasma, three species of Chlamydia, Neisseria gonorrhoeae and Garderella vaginalis in the 76 male sexual transmitted disease (STD) patients in Yangzhou city.
METHODSTwelve species of pathogens including Ureaplasma urealyticum (Uu), Mycoplasma hominis (Mh), Mycoplasma pneumoniae (Mpn), Mycoplasma genitalium (Mg), Mycoplasma fermentans (Mf), Mycoplasma penetrans (Mpe), Mycoplasma prium (Mpi), Chlamydia trachomatis (Ct), Chlamydia pneumoniae (Cpn), Chlamydia psittaci (Cps), Neisseria gonorrhoeae (Ng) and Garderella vaginalis (GV) were detected by nested polymerase chain reaction including PPNG.
RESULTSThe positive rates of Uu, Mh, Mpn, Mg, Mf, Mpe, Ct, Ng were 64.5%, 27.6%, 26.3%, 18.4%, 2.6%, 2.6%, 31.6%, 36.8%, in which Penicillinase-producing neisseria gonorrhoeae (PPNG) accounted for 14.3%, GV 15.8%. No Mpi, Cpn or Cps were found. There was more significant therapeutic effects on the detectable rate of Mycoplasma nucleic acid between positive gonococcus and negative gonococcus in male STDs patients (chi(2) = 3.848, P < 0.05).
CONCLUSIONThe infection rates of Mycoplasma, Chlamydia, Ng and GV were high among male STD patients in Yangzhou city. In clinical practice, more attention should be paid on correct diagnosis and treatment for patients, with Gonococcus, Chlamydia, Mycoplasma and GV.
Adult ; China ; Chlamydia ; classification ; genetics ; DNA, Viral ; genetics ; Gardnerella vaginalis ; classification ; genetics ; Gram-Negative Bacteria ; classification ; genetics ; Humans ; Male ; Middle Aged ; Mycoplasma ; classification ; genetics ; Neisseria ; classification ; genetics ; Polymerase Chain Reaction ; RNA, Ribosomal, 16S ; genetics ; RNA, Ribosomal, 23S ; genetics ; Sexually Transmitted Diseases ; microbiology
8.Research progress on immunocyte senescence - review.
Bo YANG ; Xiao-Hua CHI ; Xue-Chun LU ; Shuai TUO ; Feng ZHANG ; Wen-Ying ZHANG ; Chao-Wei TUO ; Wei-Dong HAN ; Shan-Qian YAO
Journal of Experimental Hematology 2012;20(3):782-787
The function of immune system degenerates in an aging-dependent manner and this results in immunosenescence. Human immune system includes two parts: genetic/innate immunity and adaptive immunity. The former is involved in monocytes, nature killer cells, and dendritic cells, the later is involved in acquired B and T lymphocytes. During the aging of immunity system, the both parts of immunity are damaged to some degree. Generally, innate immunity seems well-retained and the acquired immunity is degenerative seriously with aging. Immunocyte senescence is closely related to the elderly decreased ability to control infectious disease, cancer and to their generally poor response to vaccination. This review summarized the research progress on immunosenescence characteristics in aged phase.
Age Factors
;
Aging
;
immunology
;
Antibody Formation
;
immunology
;
Cellular Senescence
;
Humans
;
Immunity, Cellular
;
immunology
;
Lymphocyte Activation
9.Comparison of double mini locking plate and anatomical locking plate in the treatment of comminuted olecranon fracture
Shuai JI ; Teng MA ; Qian WANG ; Yao LU ; Ming LI ; Cheng REN ; Hongfei QI ; Yu CUI ; Bing DU ; Yanling YANG ; Kun ZHANG ; Zhong LI
International Journal of Surgery 2022;49(7):442-447,F3
Objective:To compare the efficacy of double mini locking plate and anatomical locking plate in the treatment of comminuted olecranon fracture.Methods:The clinical data of 46 patients who underwent comminuted olecranon fracture in the Xi′an Honghui Hospital Affiliated to Xi′an Jiaotong University from March 2017 to May 2020 were analyzed retrospectively. Among them, 21 cases were treated with double mini locking plate (double plate group) and 25 cases with anatomical locking plate (single plate group). The operation time, patient satisfaction, range of motion, return to work time, soft tissue stimulation to remove internal fixation, Mayo elbow performance score (MEPS), disabilities of arm, shoulder and hand score (DASH) of the two fixation methods were statistically compared. Measurement data with normal distribution were represented as ( ± s), and comparison between groups was conducted using the t test. Comparison between groups of count data was conducted using the chi-square test or Fisher exact probability. Results:All 46 patients were followed up for to (19.17±2.79) months. All fractures healed after operation. There was no significant difference in operation time, range of motion, patient satisfaction, MEPS and DASH scores among the two groups( P>0.05). The time of returning to work was (8.47±2.13) weeks in the double plate group and (9.78±1.98) weeks in the single plate group, and the difference was statistically significant ( P< 0.05). There were 9 cases of internal fixation due to soft tissue stimulation, 1 cases in double plate group and 8 cases in single plate group, and the difference was statistically significant ( P<0.05). Conclusions:Compared with anatomical locking plate, the treatment of olecranon fracture with double mini locking plate can effectively reduce soft tissue stimulation and promote patients to return to work early, and the operation time is not significantly prolonged, and the biomechanical advantage is obvious, the clinical effect is satisfactory and the postoperative function is good, so it is an effective treatment.
10.The changes in secretory phenotypes of senescent human gastric epithelial cells
Haili XU ; Jingyun WANG ; Wenquan LU ; Tingting YAO ; Shuai LV ; Xin LI ; Hanbing NING
Chinese Journal of Geriatrics 2018;37(5):518-521
Objectives To investigate the effects of cell aging on the disorders relating to gastric mucosa aging.Methods A treatment of 200 μmol/L H2O2 was used to induce senescence of human gastric epithelial cell line GES-1,and the cell growth curve was monitored.Senescence secretory phenotypes were observed by detecting the protein level of p53 and p16INK4a with senescence-associated β-galactosidase(SA-β gal)staining and Western blot testing.The mRNA levels of senescence-associated secretory phenotype(SASP)factors in human gastric epithelial GES-1 cell including IL-1β,IL-6,IL-8,TGF-β、IFN-γ,and VEGF-A were detected by RT PCR.The mRNA expression levels of IL-1β,IL-6,IL-8,TGF-β,IFN-γ,and VEGF in the conditioned medium were detected by ELISA analysis.Results The 200 μmol/L H2O2-induced GES-1 cells stopped proliferating after 3 days of treatment,and cells enlarged and flattened at 10 days.The increased SA-β-gal staining(P<0.001) and the increased expression levels of p53 and p16INK4a proteins indicated the success of establishing the aging model of GES-1.The mRNA levels of IL 1β,IL6,IL8,TGF-β,and IFNγ were higher(t=2.94,3.38,3.15,3.64,2.97;P=0.015,0.000,0.000,0.000,0.000)and the mRNA level of VEGF-A was lower(t=2.31,P =0.20) in senescent GES-1 cells than in the control group.In the conditioned medium of senescent GES-1 cells,the levels of IL-1β,IL6,IL8,TGF-β1,and IFNγ were higher in the H2O2-induced group [(3.12±0.21)μg/L,(4.26±0.15)μg/L,(3.37±0.14)μg/L,(5.34±0.19)μg/L,and(2.90±0.47)μg/L]than in the negative control group[(0.24±0.04,0.04±0.07,0.52±0.02,1.05±0.10,0.52±0.02,respectively,P<0.001)],while the level of VEGF was lower in the H2O2-induced group than in the negative control group(0.21±0.03)μg/L vs (0.59±0.07)μg/L(P<0.05).Conclusions The changes in senescence-associated secretory phenotype factors of the aging human gastric epithelial cells induced by oxidative stress may promote chronic gastritis and gastric cancer.