1.Clinical significance of determination of serum concentration of testosterone and adiponectin level in old male patients with T2DM and CHD
Peiyun FAN ; Huan ZHOU ; Jiajia LIU
Chongqing Medicine 2017;46(11):1469-1471
Objective To explore the significance of changes of serum adiponectin and testosterone levels in old male patients with type 2 diabetes mellitus(T2DM) and coronary heart disease(CHD).Methods A total of 122 male patients(more than 60 years old)were enrolled into this study,T2DM patients without CHD(T2DM group,n =40);T2DM patients with CHD (CHD group,n=38);control group(n=44,44 cases of physical healthy men over the age of 60 in Qinghai Provincial People's Hospital from November 2014 to September 2015).The serum of fasting blood-glucose,glycosylated hemoglobin(HbAlc) and blood lipid were detected by Roche cobas 800 full automatic biochemical analyzer,the serum concentration of testosterone(T) was determined by the chemiluminesent immunoassay,serum adiponectin(APN)levels were determined by the enzyme linked immunosorbent assay,the serum insulin(FINS)levels were evaluated by chemiluminescence method,according to the steady-state model evaluation method for calculation of insulin resistance (HOMA-IR),the difference among the three sets of the above indexes indicators were compared,and the correlation between APN and other indicators above were analyzed.Results Compared with control group,the serum T and APN levels in the T2DM group and CHD group were significantly decrease,and the CHD group was the most obviously (P<0.05).Compared with control group,the FPG,FINS,triglycerides(TG),low density lipoprotein cholesterol(LDL-C)and homeostasis model assessment-insulin resistance (HOMA-IR) levels in T2DM group and CHD group were apparently higher,and the CHD group was the most obviously (P< 0.05).The serum adiponectin was negative correlated with TG (r=-0.363),LDL-C(r=-0.417),HOMA-IR(r =-0.602),while positively correlated with HDL-C(r=0.485),T(r=0.624).The serum T was negative correlated with LDL-C(r=-0.457),HOMA-IR(r-0.643),while positively correlated with HDL-C(r=0.478),P<0.05.Conclusion The level of the serum APN and the serumtin T2DM patients with CHD are significantly lower than the patients without CHD,the serum adiponectin and the serum testosterone may promote the development of T2DM with CHD.
2.Factors regulating the adipo-osteogenic differentiation of bone marrow mesenchymal stem cells
Xin ZHOU ; Jiajia ZHAO ; Lili CHEN
Chinese Journal of Tissue Engineering Research 2017;21(17):2759-2765
BACKGROUND: Bone marrow mesenchymal stem cells (BMSCs) with multiple differentiation potential can be induced into osteogenic or adipogenic differentiation under certain conditions. OBJECTIVE: To review the related factors regulating the adipo-osteogenic differentiation of BMSCs. METHODS: A computer-based search of CNKI and PubMed databases was performed for literature concerning the related factors regulating the adipo-osteogenic differentiation of BMSCs published from January 2006 to August 2016. The search terms were bone marrow mesenchymal stem cells, osteogenic differentiation, adipocyte differentiation in Chinese and English, respectively. RESULTS AND CONCLUSION: Signaling pathways, transcription factors, and smal molecule compounds that are interacted are key factors in the regulation of BMSCs differentiation, so the techniques to intervene BMSCs differentiation based on these key molecules may correct bone or fat abnormality and can be applied to tissue engineering and regenerative medicine in the future. Additionally, the biological clock is also one of the most important factors for adipo-osteogenic differentiation of BMSCs by regulating signaling pathways or transcription factors.
3.Review and Prospect of Integrated Medical and Health Service System
Xinglong XU ; Lulin ZHOU ; Jiajia WEI
Chinese Health Economics 2017;36(7):17-21
Objective:Based on the unreasonable structure,fragmentization and insufficient resources of medical and health service system in China,the literature review was conducted on the analysis of integrated medical and health service system.Methods:It sorted out and analyzed the existing related literature in the academic field.Results:The integrated health system was developed by their elements and methods,which lacked the evaluation and analysis on the responsibility among different stake holders and effects after the integration.Conclusion:Further research should be developed into the implementation of dual referral based on integrated health system;the responsibility relationship among different stakeholders in the integration progress,the integration and optimization of medical and health service system under the background of Internet+,etc.
4.Anti-chronic stress effect of bone marrow mesenchymal stem cell transplantation in rats with spinal cord injury
Jiajia SUN ; Jun ZHOU ; Huilin YANG
Chinese Journal of Trauma 2016;32(4):337-343
Objective To investigate the anti-chronic stress effect of bone marrow mesenchymal stem cell (BMSCs) transplantation in rats with spinal cord injury.Methods Forty-eight adult SD rats were divided into control group,model group and treatment group according to the random number table,with 16 rats each.In model and treatment groups,lower thoracic (T10) spinal cord injury were constructed using the modified Allen's method.In control group,only laminectomy was performed.After 7 days,100 μl Hank's buffer suspension containing 1.0 × 106 BMSCs was injected into the subarachnoid space of L4-5 intervertebral space of rats in control group and treatment group.While in model group,only the equal volume of Hank's buffer was used.Basso-Beattie-Bresnahan (BBB) scale was performed to evaluate hindlimb motor function in rats.At postoperative 14 and 28 days,blood samples were collected to measure adrenocorticotropic hormone (ACTH),norepinephrine (NE),epinephrine (E) and corticosterone (CORT) using the ELISA method;brains were harvested for the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor proteins GluR1 and GluR2 immunohistochemical staining.Results After injury,BBB scores in model and treatment groups were similar,but both were lower than that in control group (P < 0.05).After BMSCs transplantation,BBB score in treatment group [21 d:(9.85 ± 0.82)points and 28 d:(11.23 ±0.68)points] improved continuously compared to model group [21 d:(8.42 ± 0.39) points and 28 d:(8.84 ± 0.25) points],but all were lower than that in control group [(21.00 ±0.00)points,P <0.05].ACTH contents in model and treatment groups at 14d [(104.80±6.16) and (98.50 ± 4.07) pg/ml] and 28 d [(101.40±2.33) and (96.50± 2.28) pg/ml] were higher than those in control group [(90.40 ± 1 1.36) and (83.20 ± 5.22) pg/ml] (P < 0.05).CORT contents in model and treatment groups [(44.40 ± 1.44) and (43.30 ± 1.17) ng/ml] was lower than that in control group [(48.20 ± 2.27) ng/ml] at 14 d,but were found to be elevated [(70.40 ± 1.90) and (61.40 ± 1.83) ng/ml] compared to control group [(46.40 ± 1.49) ng/ml] at 28 d (P < 0.05).Meanwhile,the CORT content in treatment group was lower than that in model group (P < 0.05).Changes in NE and E contents among the groups were similar with ACTH.Immunohistochemical staining suggested the amounts of GluR1 and GluR2 positive cells in treatment group lowered compared to control group (P < 0.05),but increased in model group compared to control group (P < 0.05).Conclusion BMSCs transplantation can improve the hindlimb motor function,contribute to reducing the secretion of stress-related hormones ACTH,CORT,NE and E,and down-regulate the expression of AMPA receptor proteins GluR1 and GluR2 in rats with spinal cord injury,suggesting a potential role in antichronic stress.
5.Relationship between expression of Kiss-1 and nm23 and lymph node metastasis in breast cancer
Bo ZHOU ; Fei XIE ; Jiajia GUO ; Deqi YANG
China Oncology 2001;0(03):-
Background and purpose:Kiss-1 and nm23 have been identifi ed as tumor metastasis suppressor genes,and they have been associated with the metastatic potential of breast cancer.The purpose of this study was to evaluate the relationship of Kiss-1 and nm23 expression with lymph node metastasis in breast cancer.Methods:The expression of Kiss-1 and nm23 protein was detected by immunohistochemistry in 70 patients with breast cancer.Results:The positive rate of Kiss-1 and nm23 were 62.86% and 68.57%,38.46% and 50.00% in breast cancer patients with lymph node metastasis,markedly lower than the 77.27%,and 79.55% in patients without lymph node metastasis(P
6.The relationship among structural empowerment, nurses' job stress and burnout
Jiajia GUO ; Zuoxia ZHOU ; Hui ZHAO ; Wei WANG
Chinese Journal of Practical Nursing 2013;(3):31-35
Objective To investigate the status of structural empowerment,job stress and burnout,and to explore the relationship aunong them.Methods The questionnaires of CWEQ-Ⅱ,job stressors and MBI were used to investigate 350 nurses working at tertiary-level hospitals.Results The average score of CWEQ-Ⅱ was (2.23±0.59),the score of EE of MBI was (29.75±13.94),PA was (27.40±11.21),both of them showed a high level of exhaustion,DP was (8.07±5.82),which showed a middle level of exhaustion.The findings showed that workload and time pressure were the most frequently encountered job stressor among staff nurses,the score was (3.23±0.95).There was a significant correlation among structural empowerment,job stressors and the level of burnout.Hierarchical regression analysis and structural equation modeling showed that structural empowerment had significant influence on every factor of job stressors and burnout,job stressors had significant influence on the every factors of burnout.Conciusins It is suggested to pay attention to the main job stressors,and take proper interventions to enhance nurses' structural empowerment to prevent burnout,and thereby to raise the quality of care.
7.Expression and activity identification of a human nasopharyngeal carcinoma I50 anti-idiotype antibody
Jiajia WANG ; Yalin LI ; Fengjie GUO ; Guohua ZHOU ; Guancheng LI
Journal of Central South University(Medical Sciences) 2011;36(3):185-191
Objective To obtain I50 anti-idiotype antibody and identify its activity in vitro.Methods I50 anti-idiotype (Id) antibody gene was amplified from the template of fuse 5-I50 by PCR to construct a prokaryotic expression vector pET25b-I50. The expression of pET25b-I50 in E. coli BL21(DE3) was induced by isopropylthio-β-D-galactopyranoside (IPTG) and was confirmed by SDS-PAGE and Western blot with Ab1(FC2) monoclonal antibody and an anti-hexahistidine tag antibody. The method of dialysis refolding was used to restore the activity of I50 anti-Id antibody, which was measured by Dot-ELISA and lymphocyte proliferation assay. Results The recombinant vector was successfully constructed and the recombinant protein was successfully expressed and purified with 90% purity. The relative molecular weight of the expressed protein was 15 kD, which was in accordance with expectation. The activity of I50 anti-Id antibody could be restored and could promote the proliferation of lymphocyte in a dose-dependent manner. Conclusion These results suggested that I50 anti-Id protein vaccine is likely an option in the therapy against nasopharyngeal carcinoma in vivo.
8.Identification and Immune response of Murine MAGE-3 Derived MHC-Ⅰ/MHC-ⅡRestricted Peptide Epitope
Zhihua LI ; Jun YANG ; Jiajia ZHOU ; Rufu CHEN
Journal of Sun Yat-sen University(Medical Sciences) 2010;31(1):138-140
[Objective] To design routine MAGE-3 derived MHC-I/MHC-II restricted peptide epitope, which containing CD4~+-CD8~+ T cell epitope peptides antigen. [Methods] The epitope peptides were made through computer simulation designing, and peptide epitopes qualification tests were performed after the synthesis of peptide antigen, ELISPOT and cell-toxic analysis were used to evaluate the proliferation ability and cytokine-release ability of peptide-stimulated T cell. [Results] The sequence of obtained MAGE-3 derived restricted epitope peptide was FITC-YEEYYPLIFLDNDQETMETSEEEEYEEYYPLIF, of which the purity ≥ 90% tested by high performance liquid chromatography. MAGE-3 epitope peptide antigen could induce T lymphocyte proliferation, and induce T lymphocyte to secret IFN-γ, which higher than that of the control group (49 vs. 6 spots/10~6, P≤0.05 ). MAGE-3 epitope peptide could induce cytotoxic T lymphocytes to cause 42% of MFC cell lysis rupture, higher than control group (P≤0.05). [Conclusion] CD4~+-CD8~+ T cell epitope MAGE-3 peptide antigen showed considerable immunological effect in vitro, and such a peptide antigen can work as therapeutic polypeptide vaccine for H-2K~K mice gastric cancer which express MAGE-3 antigen.
9.Intracranial branch atheromatous disease and ischemic stroke
Shuangqing WANG ; Liang ZHOU ; Jia YIN ; Jiajia ZHU ; Zheng ZHONG
International Journal of Cerebrovascular Diseases 2014;22(2):150-153
Intracranial branch atheromatous disease (BAD) was proposed by Caplan in 1989.It has been widely studied in Japan in recent years.With the application of high-resolution magnetic resonance,BAD has become a hot topic.This article reviews the concept,etiology,pathology,diagnosis and treatment of BAD as well as its relationship with ischemic stroke.
10.Changes of sex hormone level in perinatal depression in different perinatal periods
Qing HE ; Jiajia HU ; Borong ZHOU ; Yingtao LI
Chinese Journal of Perinatal Medicine 2016;19(5):340-344
Objective To study the correlation between the changes of sex hormone level in different perinatal periods and perinatal depression (PND). Methods Between February 2014 and February 2015, 300 pregnant women from the Third Affiliated Hospital of Guangzhou Medical University were enrolled in this study. In the first trimester (12 weeks), the third trimester (34 weeks) and postpartum period (7 and 42 days), blood samples were collected and radioimmunoassay was performed to detect the levels of sex hormones, including estrogen, progesterone, prolactin, luteinizing hormone and follicle-stimulating hormone. Self Depression Scale and Edinburgh Postnatal Depression Scale were used for psychological assessment, and PND was diagnosed by psychiatrists as PND group, and non-PND cases served as control group. Two-sample t-test, variance analysis and Bonferroni test were used to compare the changes of sex hormones at different time points between the two groups. Results A total of 180 pregnant women completed the four stages of research. Fifity-four cases were diagnosed as PND, including 10 cases in the first trimester, 16 new cases in the third trimester, 14 new cases at postpartum 7 days, and 14 new cases at postpartum 42 days. (1) Comparison of the sex hormone levels between the two groups:The estrogen levels of the first trimester, the third trimester and postpartum 7 and 42 days in PND group were (4 107.30±344.68), (13 261.60±593.32), (1 281.70±151.54) and (161.40±12.21) pmol/L, and lower than in the control group [(8 619.60±514.92), (14 330.00±353.15), (3 585.90±150.83) and (270.50±11.86) pmol/L, respectively] (all P<0.05). The progesterone levels of the first trimester and postpartum 7 and 42 days in PND group were (105.49±20.40), (24.23±3.53) and (6.40±3.53) nmol/L, and higher than those in the control group [(85.80±19.06), (5.71±2.36) and (3.87±2.03) nmol/L] (t=-2.389, -2.660 and -2.103, all P<0.05). The prolactin and luteinizing hormone levels of the postpartum 42 days in PND group were lower than in the control group [(9.40±1.69) vs (17.50±1.64)μg/L, t=-4.059;(0.32±0.21) vs (2.21±0.17) mU/L, t=-12.302] (both P<0.05). The levels of follicle-stimulating hormone in the first trimester, the third trimester and postpartum 7 days were not detectable in both groups, but PND group had a lower level at postpartum 42 days than the control group [(2.22±0.58) vs (3.15±0.29) mU/L, t=-15.525, P=0.000]. (2) Sex hormone levels at different time points:There were significant differences in estrogen levels between the four time points in both groups. There was significant difference in progesterone in the PND group at four time points, while in the control group, significant differences were found between postpartum 42 days and the first and third trimester. Prolactin levels were lowest at postpartum 42 days in both groups among the four time points (Bonferroni test, all P<0.05). Conclusions Low estrogen levels and high progesterone levels and their changes in perinatal period may be correlated with PND.